COX-2 (human) Blocking Peptide Reference: 360107-200 Peptide Sequence: human COX-2 amino acids 567-599 (SVPDPELIKTVTINASSSRSGLDDINPTVLLKE)(2) · To be used in conjunction with Cayman’s COX-2 (human) Polyclonal Antibody (Item No. 160107) or the COX-2 (human) monoclonal antibodies (Item Nos. 160112 | 160113 | 160122) to block protein-antibody complex formation during analysis for COX-2.
COX-1 (ovine) Blocking Peptide Reference: 360108-200 Peptide Sequence: ovine COX-1 amino acids 272-282 (LMHYPRGIPPQ)(919) · To be used in conjunction with Cayman’s COX-1 (ovine) polyclonal antiserum (Catalog No. 160108) to block protein-antibody complex formation during analysis for COX-1.
COX-1 (mouse) Blocking Peptide Reference: 360109-200 Peptide Sequence: murine COX-1 amino acids 274-288 (LMRYPPGVPPERQMA)(300) · To be used in conjunction with Cayman’s COX-1 (mouse) polyclonal antibody (Item No. 160109) to block protein-antibody complex formation during analysis for COX-1.
Prostaglandin E Synthase-1 (microsomal) Blocking Peptide Reference: 360140-1 Peptide Sequence: human amino acids 59-75 (CRSDPDVERSLRAHRND)(7229) · To be used in conjunction with Cayman’s microsomal PGE synthase-1 polyclonal antibody (Catalog No. 160140) to block protein-antibody complex formation during analysis for microsomal PGE synthase.
Prostaglandin E Synthase (cytosolic) Blocking Peptide Reference: 360150-1 Peptide sequence: human cPGE synthase amino acids 58-67 (CIDPNDSKHK)(8691) · To be used in conjunction with Cayman’s cPGEsynthase polyclonal antibody (Catalog No. 160150) to block protein-antibody complex formation during analysis for cPGE synthase.
5-Lipoxygenase Blocking Peptide Reference: 360402-200 Peptide Sequence: human and rat amino acids 130-149 (QHRRKELETRQKQYRWMEWN)(4212,4211,4210) · To be used in conjunction with Cayman’s 5-LO polyclonal antiserum (Catalog No. 160402) to block protein-antibody complex formation during analysis for 5-LO.
sPLA2 (mouse Type V) Blocking Peptide Reference: 360512-200 Peptide sequence: mouse group V sPLA2 amino acids 79-94 (CAIRTQSYDYRYTNGL) · To be used in conjunction with Cayman’s sPLA2 (mouse type V) polyclonal antibody (Item No. 160512) to block protein-antibody complex formation during analysis for sPLA2 (type V).
PAF Receptor Blocking Peptide (Monoclonal) Reference: 360600-1 Peptide Sequence: human amino acids 260-269 (LGFQDSKFHQ).(5109,5148,5150) · To be used in conjunction with Cayman’s PAF receptor monoclonal antibody (Catalog No. 160600) to block protein-antibody complex formation during analysis for PAF.
PAF Acetylhydrolase Blocking Peptide Reference: 360603-200 Peptide Sequence: human C-terminal amino acids 420-441 (TNINTTNQHIMLQNSSGIEKYN)(2618) · To be used in conjunction with Cayman’s PAF-AH polyclonal antiserum (Catalog No. 160603) to block protein-antibody complex formation during analysis for PAF-AH.
15-hydroxy Prostaglandin Dehydrogenase Blocking Peptide Reference: 360615-200 Peptide Sequence: amino acids 92-105 (AGVNNEKNWEKTLQ) from the human NAD+-dependent 15-hydroxy PGDH(387) · To be used in conjunction with Cayman’s 15-hydroxy PGDH polyclonal antibody (Catalog No. 160615) to block protein-antibody complex formation during analysis for 15-hydroxy PGDH.
Prostaglandin I Synthase Blocking Peptide Reference: 360640-200 Peptide Sequence: bovine amino acids 299-329 (LLKNPEALAAVRGELETVLLGAEQPISQMTT)(3477,3476,3478) · To be used in conjunction with Cayman’s PGIS polyclonal antibody (Catalog No. 160640) to block protein-antibody complex formation during analysis for PGIS.
Thromboxane Synthase Blocking Peptide Reference: 360715-200 Peptide Sequence: human amino acids 359-377 (TNPDCQEKLLREVDVFKEK)(50,4150) · To be used in conjunction with Cayman’s thromboxane synthase polyclonal antibody (Catalog No. 160715) to block protein-antibody complex formation during analysis for thromboxane synthase.