EP2 Receptor Blocking Peptide Reference: 301750-200 Peptide Sequence: human EP2 receptor amino acids 335-358 (SLRTQDATQTSCSTQSDASKQADL)(3178) · To be used in conjunction with Cayman’s EP2 receptor polyclonal antibody (Catalog No. 101750) to block protein-antibody complex formation during immunochemical anaylsis for the EP2 receptor.
EP3 Receptor Blocking Peptide Reference: 301760-1 Peptide Sequence: human EP3 receptor sequence amino acids 308-327 (NQTSVEHCKTHTEKQKECNF)(3180,1900) · To be used in conjunction with Cayman’s EP3 receptor polyclonal antibody (Catalog No. 101760) to block protein-antibody complex formation during immunochemical analysis for the EP3 receptor.
EP4 Receptor (C-Term) Blocking Peptide Reference: 301775-200 Peptide Sequence: human EP4 receptor sequence amino acids 459-488 (GSGRAGPAPKGSSLQVTFPSETLNLSEKCI)(3164,3186) · To be used in conjunction with Cayman’s EP4 receptor polyclonal antibody (Catalog No. 101775) to block protein-antibody complex formation during immunochemical analysis for the EP4 receptor.
RICK Blocking Peptide Reference: 301785-200 Peptide Sequence: human RICK sequence amino acids 11-30 (PTIPYHKLADLRYLSRGASG) · To be used in conjunction with Cayman’s RICK polyclonal antibody (Catalog No. 160785) to block protein-antibody complex formation during immunochemical analysis of RICK
BLT2 Receptor Blocking Peptide Reference: 320124-200 Peptide sequence: human BLT2 receptor amino acids 325-338 (MELRTTPQLKVVGQ)(8743,8280,8525) · To be used in conjunction with Cayman’s BLT2 receptor polyclonal antibody (Catalog No. 120124) to block protein-antibody complex formation during analysis for the BLT2 receptor.
CysLT1 Receptor Blocking Peptide Reference: 320500-200 Peptide Sequence: human CysLT1 receptor amino acids 318-337 (TYVPRKKASLPEKGEEICKV)(7174) · To be used in conjunction with Cayman’s CysLT1 receptor polyclonal antibody (Catalog No. 120500) to block protein-antibody complex formation during analysis for the CysLT1 receptor.
CysLT2 Receptor (C-Term) Blocking Peptide Reference: 320550-1 Peptide Sequence: human CysLT2 receptor amino acids 330-346 · To be used in conjunction with Cayman’s CysLT2 Receptor (C-Term) Polyclonal Antibody (Catalog No. 120550) to block protein-antibody complex formation during analysis for CysLT2 Receptor (C-Term)
CysLT2 Receptor (N-Term) Blocking Peptide Reference: 320560-200 Peptide Sequence: human CysLT2 receptor N-terminal amino acids 1-18 (MERKFMSLQPSISVSEME)(8519,9059) · To be used in conjunction with Cayman’s CysLT2 receptor (N-term) polyclonal antibody (Catalog No. 120560) to block protein-antibody complex formation during analysis for the CysLT2 receptor.
Prostaglandin D Synthase (lipocalin-type) Blocking Peptide Reference: 360003-200 Peptide Sequence: human lipocalin-type PGD synthase amino acids 30-41 (VQPNFQPDKFLG)(8449) · To be used in conjunction with Cayman’s lipocalin-type PGD synthase polyclonal antibody (Catalog No. 160003) to block protein-antibody complex formation during analysis for PGD synthase.
Prostaglandin D Synthase (hematopoietic-type) Blocking Peptide Reference: 360013-200 Peptide Sequence: Human hematopoietic type PGD synthase amino acids 30-41 (EDHRIEQADWPE)(8451) · To be used in conjunction with Cayman’s hematopoietic type PGD synthase polyclonal antibody (Catalog No. 160013) to block protein-antibody complex formation during analysis for hematopoietic type PGD synthase.
IP Receptor (mouse) Blocking Peptide Reference: 360070-1 Peptide Sequence: human IP receptor amino acids · To be used in conjunction with Cayman’s IP receptor (mouse) polyclonal antibody (Item No. 160070) to block protein-antibody complex formation during immunochemical analysis for the IP receptor.
COX-2 (mouse) Blocking Peptide Reference: 360106-200 Peptide Sequence: murine COX-2 amino acids 570-598 (DPQPTKTATINASASHSRLDDINPTVLIK)(1982) · To be used in conjunction with Cayman’s COX-2 (mouse) polyclonal antibodies (Item Nos. 160106, 160116, or 160126) to block protein-antibody complex formation during analysis for COX-2.