Caspase-3 (human) Blocking Peptide Reference: 360745-200 Peptide Sequence: human caspase-3 sequence amino acids 166-183 (TELDSGIETDSGVDDDMA)(8444) · To be used in conjunction with Cayman’s Caspase-3 (human) Polyclonal Antibody (Catalog No. 160745) to block protein-antibody complex formation during analysis for caspase-3.
AIF Blocking Peptide Reference: 360773-1 Peptide Sequence: human AIF amino acids 151-180 (RARDPGARVLIVSEDPELPYMRPPLSKELW) · To be used in conjunction with Cayman’s AIF polyclonal antibody (Catalog No. 160773) to block protein-antibody complex formation during analysis for AIF.
Apaf-1 Blocking Peptide Reference: 360780-200 Peptide Sequence: human Apaf-1 amino acids 12-28 (HREALEKDIKTSYIMDHC); the sequence of the peptide is identical between human and mouse.(6894,6873) · To be used in conjunction with Cayman’s Apaf-1 polyclonal antibody (Catalog No. 160780) to block protein-antibody complex formation during analysis for Apaf-1.
nNOS Blocking Peptide Reference: 360871-200 Peptide Sequence: human nNOS amino acids 1422-1433 (ESKKDTDEVFSS)(1280,4153) · To be used in conjunction with Cayman’s nNOS polyclonal antibody (Catalog No. 160870) to block protein-antibody complex formation during analysis for nNOS.
eNOS Blocking Peptide Reference: 360881-200 Peptide Sequence: human eNOS amino acids 1186-1203 (RGAVPWAFDPPGSDTNS) · To be used in conjunction with Cayman’s eNOS polyclonal antiserum (Item No. 160880) to block protein-antibody complex formation during analysis for eNOS.
Guanylate Cyclase α subunit (soluble) Blocking Peptide Reference: 360895-200 Peptide sequences: human guanylate cyclase α subunit amino acids 418-436 (EQARAQDGLKKRLGKLKAT) · To be used in conjunction with Cayman’s guanylate cyclase α subunit polyclonal antibody (Catalog No. 160895) to block protein-antibody complex formation during analysis for guanylate cyclase α subunit.
Guanylate Cyclase β1 subunit (soluble) Blocking Peptide Reference: 360897-200 Peptide Sequence: soluble rat guanylate cyclase β1 subunit, amino acids 188-207 (EDFYEDLDRFEENGTQDSR; last D=E in human and bovine)(3531,4654,3535) · To be used in conjunction with Cayman’s guanylate cyclase β1 subunit (soluble) polyclonal antibody (Catalog No. 160897) to block protein-antibody complex formation during analysis for guanylate cyclase.
APRIL peptide Reference: GTX00459 The protein encoded by this gene is a member of the tumor necrosis factor (TNF) ligand family. This protein is a ligand for TNFRSF17/BCMA, a member of the TNF receptor family. This protein and its receptor are both found to be important for B cell development. In vitro experiments suggested that this protein may be able to induce apoptosis through its interaction with other TNF receptor family proteins such as TNFRSF6/FAS and TNFRSF14/HVEM. Alternative splicing results in multiple transcript variants. Some transcripts that skip the last exon of the upstream gene (TNFSF12) and continue into the second exon of this gene have been identified; such read-through transcripts are contained in GeneID 47977, TNFSF12-TNFSF13. [provided by RefSeq, Oct 21]
Syntrophin gamma 1 blocking peptide Reference: GTX10079-PEP The protein encoded by this gene is a member of the syntrophin family. Syntrophins are cytoplasmic peripheral membrane proteins that typically contain 2 pleckstrin homology (PH) domains, a PDZ domain that bisects the first PH domain, and a C-terminal domain that mediates dystrophin binding. This gene is specifically expressed in the brain. Transcript variants for this gene have been described, but their full-length nature has not been determined. [provided by RefSeq, Jul 28]
VPS35 blocking peptide Reference: GTX10099-PEP This gene belongs to a group of vacuolar protein sorting (VPS) genes. The encoded protein is a component of a large multimeric complex, termed the retromer complex, involved in retrograde transport of proteins from endosomes to the trans-Golgi network. The close structural similarity between the yeast and human proteins that make up this complex suggests a similarity in function. Expression studies in yeast and mammalian cells indicate that this protein interacts directly with VPS35, which serves as the core of the retromer complex. [provided by RefSeq, Jul 28]
VPS28 blocking peptide Reference: GTX10133-PEP This gene encodes a protein involved in endosomal sorting of cell surface receptors via a multivesicular body/late endosome pathway. The encoded protein is one of the three subunits of the ESCRT-I complex (endosomal complexes required for transport) involved in the sorting of ubiquitinated proteins. The two other subunits of ESCRT-I are vesicular protein sorting 23, also known as tumor susceptibility gene 11 (TSG11), and vesicular protein sorting 37. Two alternative transcripts encoding different isoforms have been described. Additional alternative transcripts may exist but the proteins encoded by these transcripts have not been verified experimentally. [provided by RefSeq, Jul 28]