Category: Peptides

Reference: P4084
€0.00 (tax incl.)
Synonyms: Cmpt, GDF-8, GDF8_HUMAN, Growth/differentiation factor 8, MSLHP, MSTN, MSTN myostatin, Myostatin, Myostatin Propeptide. Lyophilized from a 0.2um filtered solution in PBS with 5% trehalose, pH7.4
Reference: P4799
€0.00 (tax incl.)
Synonyms: ANP-A, ANPa, ANPR-A, ANPRA, ANPRA_HUMAN, Atrial natriuretic peptide A type receptor, Atrial natriuretic peptide receptor 1, Atrial natriuretic peptide receptor A, Atrial natriuretic peptide receptor type A,...
Reference: A02-58-1000
€0.00 (tax incl.)
The Abltide peptide sequence (EAIYAAPFAKKK) is based on the C-terminus of Abl.
Reference: H12-358-500
€0.00 (tax incl.)
The Acetylated Histone H3 (K9, 14) Peptide sequence (ARTKQTAR[Ac-K]STGG[Ac-K]APRKQLAGGKKC) is derived from human histone H3 (1-21) and is suitable for use as the assay control of histone (de-)methylation and (de-)...
Reference: H13-358-500
€0.00 (tax incl.)
The Acetylated Histone H4 (K5, 8, 12, 16) Peptide sequence (SGRG[Ac-K]GG[Ac-K]GLG[Ac-K]GGA[Ac-K]RHRKVGGKKC) is derived from human histone H4 (1-21) and is suitable for use as the assay control of histone...
Reference: A11-58
€0.00 (tax incl.)
The AMARA substrate peptide sequence (AMARAASAAALARRR) is routinely evaluated as a substrate for SIK and AMPK.
Reference: A15-58
€0.00 (tax incl.)
The Autocamtide 2 peptide sequence (KKALRRQETVDAL-amide) is based on the autophosphorylation site (amino acid 283-290) on CaMKII.
Reference: A16-58
€0.00 (tax incl.)
The Axltide peptide sequence (KKSRGDYMTMQIG) is based on the mouse Insulin receptor substrate 1 (amino acid 979-989).
Reference: C02-58
€0.00 (tax incl.)
The CATCHtide peptide sequence (CRRHYYYDTHTNTYY-LRTFGHNTRR) is derived from human SLC12A2 (amino acids 198-217) and is suitable as a substrate for kinases OSR1 and STK39.
Reference: C06-58
€0.00 (tax incl.)
The CDKtide peptide sequence (CKKKYSPTSPSYSPTSPSY-SPTSPS) is derived from the C-terminus of the largest subunit of human RNA polymerase II which has 52 approximate tandem repeats of 7 amino acids...
Reference: C10-58
€0.00 (tax incl.)
The Chktide peptide sequence (KKKVSRSGLYRSPSMPENLNRPR) is based on the human CDC25C protein isoform A (amino acid 205-225).
Reference: C07-58-1
€0.00 (tax incl.)
The CK1tide synthetic peptide [HAAIGDDDDAYSITA-NH2] is routinely evaluated as a substrate for CK1 family kinases, such as CK1 and CK1 delta.
Reference: C50-58
€0.00 (tax incl.)
The CREBtide peptide sequence (KRREILSRRPSYR) is based on the human CREB1 isoform A (amino acid 109-121).
Reference: C51-58
€0.00 (tax incl.)
The Crosstide peptide sequence (GRPRTSSFAEG) is based on the GSK3.
Reference: C63-58
€0.00 (tax incl.)
The synthetic peptide CSKtide (KKKEEIYFFFG-NH2) contains a tyrosine protein kinase phosphorylation site and can be used for CSK and TNK1 assay.
Reference: D96-58
€0.00 (tax incl.)
The synthetic peptide (RRRFRPASPLRGPPK) contains a serine/threonine protein kinase phosphorylation site and is routinely evaluated as a substrate for DYRK family kinases.
Reference: E01-58
€0.00 (tax incl.)
The EF2tide substrate peptide sequence (RKKFGESEKTKTKEFL) is based on dictyostelium myosin II heavy chain (amino acid 2020-2035).
Reference: E23-58
€0.00 (tax incl.)
The 13 amino acids of EIF2S peptide sequence (CILLSELSRRRIR) is derived from human protein EIF2S1 between residues 46-57. This peptide is suitable for use as a substrate for MNK1 and EIF2AK family kinases.
Reference: G46-58
€0.00 (tax incl.)
The synthetic peptide sequence (CRRREEEEESAAA) is routinely evaluated as a substrate for GRK family kinases, including GRK2, GRK3, GRK4 and GRK7.
Reference: G60-58
€0.00 (tax incl.)
The GS peptide sequence (PLSRTLSVSS) is derived from an N-terminus of glycogen synthase and is suitable for use as the substrate for DCAMKL1 and CAMKII family.
Reference: H10-58-1
€0.00 (tax incl.)
The Histone H1 Peptide (152-159) sequence (GGGPATP-KKAKKL-COOH) is derived from human histone H1 between amino acids 152-159 and is suitable for use as the substrate for CDK family kinase assays, such as CDK1, CDK2,...
Reference: H12-58-500
€0.00 (tax incl.)
The Histone H3 Peptide (1-21) sequence (ARTKQTARKS-TGGKAPRKQLAGGKKC) is derived from human histone H3 (1-21) and is suitable for use as the substrate for histone methyltransferase (at K4 and K9) and acetyltransferase...
Reference: H12-58-01
€0.00 (tax incl.)
The Histone H3 Peptide (1-21) sequence (ARTKQTARKS-TGGKAPRKQLAGGKKC) is derived from human histone H3 (1-21) and is suitable for use as the substrate for histone methyltransferase (at K4 and K9) and acetyltransferase...
Reference: H13-58-500
€0.00 (tax incl.)
The Histone H4 Peptide (1-21) sequence (SGRGKGGKGL-GKGGAKRHRKVGGKKC) is derived from human histone H4 (1-21) and is suitable for use as the substrate for histone methyltransferase (at R3) and acetyltransferase (at K5,...
Reference: H13-58-01
€0.00 (tax incl.)
The Histone H4 Peptide (1-21) sequence (SGRGKGGKGL-GKGGAKRHRKVGGKKC) is derived from human histone H4 (1-21) and is suitable for use as the substrate for histone methyltransferase (at R3) and acetyltransferase (at K5,...
Reference: H31-58
€0.00 (tax incl.)
The HSP27tide peptide sequence (RRLNRQLSVA-amide) is based on the mouse HSP27 (amino acid 80-85).
Reference: I15-58
€0.00 (tax incl.)
The 14 amino acids of IGF1Rtide peptide sequence (KKKSPGEYVNIEFG) is derived from human IRS-1 protein residues 891-902.
Reference: I33-58
€0.00 (tax incl.)
The IKKtide peptide sequence (KKKKERLLDDRHDSG-LDSMKDEE) is derived from human IkBA (amino acids 21-41) and is suitable as a substrate for IKK alpha and IKK beta.
Reference: I40-58-1000
€0.00 (tax incl.)
The synthetic IRS1 (Y608) Peptide [KKHTDDGYMPMSPGVA] is derived from mouse insulin receptor substrate 1 (amino acids 603-616) and is suitable as substrate for JAK1 and JAK2.
Reference: J03-58-1000
€0.00 (tax incl.)
The JAK3tide synthetic peptide [GGEEEEYFELVKKKK] is routinely evaluated as a substrate for JAK3 and JAK2.
Reference: L15-58
€0.00 (tax incl.)
The synthetic peptide LKBtide (LSNLYHQGKFLQTFCGSPLY-RRRC) is derived from human NUAK2 (amino acid 196-215) and can be phosphorylated by protein Serine/Threonine kinase 11 (STK11), also known as LKB1.
Reference: L10-58
€0.00 (tax incl.)
The LRRKtide peptide sequence (RLGRDKYKTLRQIRQ) is derived from human ezrin (amino acids 561-573), moesin (amino acids 539-553) and radixin (amino acids 558-570) and is suitable for use as a substrate for LRRK kinases.
Reference: M02-58
€0.00 (tax incl.)
The synthetic peptide (KKRFSFKKSFKL) is derived from amino acid residues 154 –165 of protein myristoylated alanine-rich C-kinase substrate (MARCKS). This peptide is suitable for use as a substrate for PKC alpha, PKC...
Reference: M08-58-1000
€0.00 (tax incl.)
The Micro2 Peptide sequence (KEEQSQITSQVTGQIGWR) is derived from human AP-2 complex subunit mu isoform b (amino acids 143-160) and is suitable as a substrate for AAK1, BMP2K, and GAK kinase assay.
Reference: M09-58
€0.00 (tax incl.)
The MLC Peptide sequence (AKRPQRATSNVFS) represents the phosphate-accepting domain of human MYL9 (amino acids 12-23) and can be used as a substrate for PHKG1, PHKG2 and DAPK2.
Reference: E23-58B
€0.00 (tax incl.)
The Modified EIF2S Peptide sequence (Modified-CILLSELSRRRIR) is derived from human EIF2S1 (46-57) and is suitable for use as the substrate for EIF2AK kinase family and MNK1.
Reference: P41-58B
€0.00 (tax incl.)
The Modified PLKtide peptide sequence (Modified-CKKLGEDQAEEISDDLLEDSLSDEDE) is derived from the CDC25C protein sequence (182-204).
Reference: S08-58B
€0.00 (tax incl.)
The Modified SGKtide peptide sequence (Modified- CKKRNRRLSVA) contains serine protein kinase phosphorylation site and is evaluated as a substrate for SGK and NDR family kinases.
Reference: M56-58
€0.00 (tax incl.)
The synthetic substrate MRCL3 Peptide (KKRPQRATSN-VFAM-NH2) is derived from human myosin regulatory light chain MRCL3 (amino acid 11-24) and can be used for MLCK, MYLK2 and MYLK3 kinase assay.
Reference: P08-58
€0.00 (tax incl.)
The 10 amino acids of PAKtide peptide (RRRLSFAEPG) contain a serine/threonine protein kinase phosphorylation site in a common seven-residue epitope (1, 2).
Reference: P57-58
€0.00 (tax incl.)
The synthetic peptide substrate PDHKtide (RRYHGHSMS-DPGVSYRTR) is derived from human PDHA1 protein (amino acid 288-304aa) and can be used for PDHK family kinase assay.
Reference: P10-58
€0.00 (tax incl.)
The 39 amino acids of PDKtide peptide sequence (KTFCGTPEYLAPEVRREPRILSEEEQEMFRDFDYIADWC) is derived from two human proteins: residues 1-14 are based on AKT1 (307-320) and residues 16-39 are based on PKN2/PRK2 (961-984).
Reference: P15-58
€0.00 (tax incl.)
The PKCtide peptide sequence (ERMRPRKRQGSVRRRV) is based on protein kinase C epsilon (amino acid 149-164).
Reference: P41-58
€0.00 (tax incl.)
The PLKtide peptide sequence (CKKLGEDQAEEISDDLLED-SLSDEDE) is derived from the CDC25C protein sequence (182-204).
Reference: P61-58
€0.00 (tax incl.)
The Poly (4:1 Glu, Tyr) substrate peptide is used as universal substrate for protein tyrosine kinases.
Reference: R06-58-
€0.00 (tax incl.)
The PS7-CTD peptide sequence (YSPTS PpSYSP TSPpS) is derived from C-terminal repeat domain of human RNA polymerase II.
Reference: R55-58
€0.00 (tax incl.)
The synthetic peptide (GRSRSRSRSRSRSRSR) contains serine/threonine protein kinase phosphorylation sites and is routinely evaluated as a substrate for CLK, EIF2AK and SRPK family kinases.
Reference: S07-58
€0.00 (tax incl.)
The SAMStide peptide sequence (HMRSAMSGLHLVKRR) is based on the mouse acetyl-Coenzyme A carboxylase alpha (amino acid 73-85).
Reference: S08-58
€0.00 (tax incl.)
The SGKtide peptide sequence (CKKRNRRLSVA) contains serine protein kinase phosphorylation site and is evaluated as a substrate for SGK and NDR family kinases.
Reference: T36-58
€0.00 (tax incl.)
The TGFBR1 peptide sequence (KKKVLTQMGSPSIRC-S(pS)VS) is derived from human SMAD3 (215-230) and is suitable for use as the substrate for TGFBR1 superfamily, including ACVRs (ALK1, ALK2, ALK4 and ALK7) and BMPRs (ALK3...
Reference: T69-58
€0.00 (tax incl.)
The Thr-phosphopeptide sequence (KRT(p)IRR) is derived from human NR2F6 (amino acids 79-84) and is suitable as a substrate for PP2A, PP2B, PP2C and PP1.
Reference: T72-58-01
€0.00 (tax incl.)
The Thr-phosphopeptide-3 sequence (RRAT(p)VA) is a phosphorylated threonyl derivative from human pyruvate kinase (amino acids 40-45) and is suitable as a substrate for PP1, PP2A, and PP2C (e.g. WIP1).
Reference: T70-58
€0.00 (tax incl.)
The Tyr-phosphopeptide-2 sub peptide sequence (DADEY(p)LIPDQG) is based on mouse epidermal growth factor receptor isoform 1 (amino acid 1014-1024).
Reference: U01-58-1
€0.00 (tax incl.)
The ULKtide synthetic peptide [YANWLAASIYLDGKKK] is routinely evaluated as a substrate for ULK family kinase assays.
Reference: Z16-58
€0.00 (tax incl.)
The ZIPtide substrate peptide sequence (KKLNRTLSFAEPG) is routinely evaluated as a substrate for DAPK3 (ZIPK).
Reference: 214-10027
€0.00 (tax incl.)

Menu

Settings