Caspase-3 (human) Blocking Peptide Reference: 360745-200 Peptide Sequence: human caspase-3 sequence amino acids 166-183 (TELDSGIETDSGVDDDMA)(8444) · To be used in conjunction with Cayman’s Caspase-3 (human) Polyclonal Antibody (Catalog No. 160745) to block protein-antibody complex formation during analysis for caspase-3.
GDNF, human, recombinant Reference: C-66312 Recombinant Human Glial Derived Neurotropic Factor (E. coli-derived)
AIF Blocking Peptide Reference: 360773-1 Peptide Sequence: human AIF amino acids 151-180 (RARDPGARVLIVSEDPELPYMRPPLSKELW) · To be used in conjunction with Cayman’s AIF polyclonal antibody (Catalog No. 160773) to block protein-antibody complex formation during analysis for AIF.
GDNF, human, recombinant Reference: C-66312A Recombinant Human Glial Derived Neurotropic Factor (plant-derived)
Apaf-1 Blocking Peptide Reference: 360780-200 Peptide Sequence: human Apaf-1 amino acids 12-28 (HREALEKDIKTSYIMDHC); the sequence of the peptide is identical between human and mouse.(6894,6873) · To be used in conjunction with Cayman’s Apaf-1 polyclonal antibody (Catalog No. 160780) to block protein-antibody complex formation during analysis for Apaf-1.
nNOS Blocking Peptide Reference: 360871-200 Peptide Sequence: human nNOS amino acids 1422-1433 (ESKKDTDEVFSS)(1280,4153) · To be used in conjunction with Cayman’s nNOS polyclonal antibody (Catalog No. 160870) to block protein-antibody complex formation during analysis for nNOS.
NNT-1 (BCSF-3), human, recombinant Reference: C-66421 Recombinant Human Novel Neurotrophin-1 (BCSF-3)
eNOS Blocking Peptide Reference: 360881-200 Peptide Sequence: human eNOS amino acids 1186-1203 (RGAVPWAFDPPGSDTNS) · To be used in conjunction with Cayman’s eNOS polyclonal antiserum (Item No. 160880) to block protein-antibody complex formation during analysis for eNOS.
Guanylate Cyclase α subunit (soluble) Blocking Peptide Reference: 360895-200 Peptide sequences: human guanylate cyclase α subunit amino acids 418-436 (EQARAQDGLKKRLGKLKAT) · To be used in conjunction with Cayman’s guanylate cyclase α subunit polyclonal antibody (Catalog No. 160895) to block protein-antibody complex formation during analysis for guanylate cyclase α subunit.