beta-NGF, human, recombinant Reference: C-66130 Recombinant Human Nerve Growth Factor beta (CHO cell-derived)
sPLA2 (mouse Type V) Blocking Peptide Reference: 360512-200 Peptide sequence: mouse group V sPLA2 amino acids 79-94 (CAIRTQSYDYRYTNGL) · To be used in conjunction with Cayman’s sPLA2 (mouse type V) polyclonal antibody (Item No. 160512) to block protein-antibody complex formation during analysis for sPLA2 (type V).
PAF Receptor Blocking Peptide (Monoclonal) Reference: 360600-1 Peptide Sequence: human amino acids 260-269 (LGFQDSKFHQ).(5109,5148,5150) · To be used in conjunction with Cayman’s PAF receptor monoclonal antibody (Catalog No. 160600) to block protein-antibody complex formation during analysis for PAF.
PAF Acetylhydrolase Blocking Peptide Reference: 360603-200 Peptide Sequence: human C-terminal amino acids 420-441 (TNINTTNQHIMLQNSSGIEKYN)(2618) · To be used in conjunction with Cayman’s PAF-AH polyclonal antiserum (Catalog No. 160603) to block protein-antibody complex formation during analysis for PAF-AH.
15-hydroxy Prostaglandin Dehydrogenase Blocking Peptide Reference: 360615-200 Peptide Sequence: amino acids 92-105 (AGVNNEKNWEKTLQ) from the human NAD+-dependent 15-hydroxy PGDH(387) · To be used in conjunction with Cayman’s 15-hydroxy PGDH polyclonal antibody (Catalog No. 160615) to block protein-antibody complex formation during analysis for 15-hydroxy PGDH.
Prostaglandin I Synthase Blocking Peptide Reference: 360640-200 Peptide Sequence: bovine amino acids 299-329 (LLKNPEALAAVRGELETVLLGAEQPISQMTT)(3477,3476,3478) · To be used in conjunction with Cayman’s PGIS polyclonal antibody (Catalog No. 160640) to block protein-antibody complex formation during analysis for PGIS.
Thromboxane Synthase Blocking Peptide Reference: 360715-200 Peptide Sequence: human amino acids 359-377 (TNPDCQEKLLREVDVFKEK)(50,4150) · To be used in conjunction with Cayman’s thromboxane synthase polyclonal antibody (Catalog No. 160715) to block protein-antibody complex formation during analysis for thromboxane synthase.