Peptides (68)

(R)-2-((Methoxycarbonyl)amino)-2-phenylacetic acid

Reference: HY-W043423

€0.00 (tax incl.)

(R)-2-((Methoxycarbonyl)amino)-2-phenylacetic acid is a Glycine (HY-Y0966) derivative.

FTISADTSK acetate

Reference: HY-P3146A

€0.00 (tax incl.)

FTISADTSK acetate is an endogenous stable signature peptide from Trastuzumab monitored by selected reaction monitoring (SRM).

PTD-p65-P1 Peptide is a potent, selective nuclear transcription factor NF-κB inhibitor and derives from the p65 subunit of NF-κB amino acid residues 271-282, which selectively inhibits NF-κB activation induced by...

Methyl 2-amino-3,3,3-trifluoropropanoate hydrochloride

Reference: HY-W050444

€0.00 (tax incl.)

Methyl 2-amino-3,3,3-trifluoropropanoate hydrochloride is an alanine derivative.

Allatostatin IV

Reference: HY-P1760

€0.00 (tax incl.)

Allatostatin IV is an octapeptide. Allatostatins are pleiotropic neuropeptides for inhibition of juvenile hormone synthesis in insects.

Gly-Arg-Gly-Asp-Ser TFA

Reference: HY-P0295A

€0.00 (tax incl.)

Gly-Arg-Gly-Asp-Ser (TFA) is a pentapeptide that forms the cell-binding domain of a glycoprotein, osteopontin. Gly-Arg-Gly-Asp-Ser binds to integrin receptors αvβ3 and αvβ5 with estimated IC50 of ∼5 and ∼6.5 μM.

H-Gly-Trp-Gly-OH

Reference: HY-P4300

€0.00 (tax incl.)

H-Gly-Trp-Gly-OH is a polypeptide.

H-D-Phe(4-Cl)OMe.HCl

Reference: HY-W011931

€0.00 (tax incl.)

H-D-Phe(4-Cl)OMe.HCl is a phenylalanine derivative.

N-(2,5-Dimethylphenylsulfonyl)-DL-leucine

Reference: HY-W032681

€0.00 (tax incl.)

N-(2,5-Dimethylphenylsulfonyl)-DL-leucine is a leucine derivative.

Cibinetide

Reference: HY-P0168

€0.00 (tax incl.)

Cibinetide (ARA290) is an EPO-derivative, acting as a specific agonist of erythropoietin/CD131 heteroreceptor, and used for neurological disease treatment.

[DPro5] Corticotropin Releasing Factor, human, rat

Reference: HY-P3684

€0.00 (tax incl.)

[DPro5] Corticotropin Releasing Factor, human, rat is a selective R2 agonist of corticotropin releasing factor/hormone. Corticotropin releasing factor (CRF) is a hypothalamic hormone, stimulates the release of...

Z-D-Arg-OH

Reference: HY-W009211

€0.00 (tax incl.)

Z-D-Arg-OH is an arginine derivative.

Prion Protein 106-126 (human)

Reference: HY-W015977

€0.00 (tax incl.)

Prion Protein 106-126 (human), a peptide fragment of prion, and can induct neuronal apoptosis, antiproteinase K digestion, fiber formation, and mediate the conversion of normal cellular prion protein (PrPc) into...

WLSEAGPVVTVRALRGTGSW TFA

Reference: HY-P3436A

€0.00 (tax incl.)

WLSEAGPVVTVRALRGTGSW TFA is a cardiomyocyte specific peptide. WLSEAGPVVTVRALRGTGSW-expressing exosomes can improve specific uptake by cardiomyocytes, decrease cardiomyocyte apoptosis, and enhance cardiac retention...

Secretin, canine

Reference: HY-P1784

€0.00 (tax incl.)

Secretin, canine is an endocrine hormone that stimulates the secretion of bicarbonate-rich pancreatic fluids. Secretin, canine can regulates gastric chief cell function and paracellular permeability in canine gastric...

H-Ile-Pro-Pro-OH

Reference: HY-114424

€0.00 (tax incl.)

H-Ile-Pro-Pro-OH, a milk-derived peptide, inhibits angiotensin-converting enzyme (ACE) with an IC50 of 5 μM. Antihypertensive tripeptides.

TAT-14 TFA

Reference: HY-P1328A

€0.00 (tax incl.)

TAT-14 TFA is a 14-mer peptide that acts as Nrf2 activator with an anti-inflammatory effect. TAT-14 TFA has no effect on Nrf2 mRNA expression, but increases Nrf2 protein level due to targeting the Nrf2 binding site on...

[Ala107]MBP(104-118)

Reference: HY-P1289A

€0.00 (tax incl.)

[Ala107]MBP(104-118) is an noncompetitive peptide inhibitors of protein kinase C (PKC), with IC50s ranging from 46-145 μM.

Icatibant

Reference: HY-17446

€0.00 (tax incl.)

Icatibant (HOE-140) is a potent and specific peptide antagonist of bradykinin B2 receptor with IC50 and Ki of 1.07 nM and 0.798 nM respectively.

c-Myc Peptide TFA

Reference: HY-P0312

€0.00 (tax incl.)

c-Myc Peptide (TFA) is a synthetic peptide corresponding to the C-terminal amino acids (410-419) of human c-myc protein, and participates in regulation of growth-related gene transcription.

Boc-Met-OSu

Reference: HY-W011167

€0.00 (tax incl.)

Boc-Met-OSu is a Methionine (HY-13694) derivative.

EGF-R (661-681) T669 Peptide

Reference: HY-P3918

€0.00 (tax incl.)

EGF-R (661-681) T669 Peptide is a MAPK substrate that can used to measure MAPK catalytic activity.

CKLF1-C27 TFA

Reference: HY-P3418A

€0.00 (tax incl.)

CKLF1-C27, a C-terminal peptide of CKLF1, binds to CCR4 receptor and activates ERK1/2 pathway. CKLF1-C27 can abrogate the effect of CKLF1 on cells by competing for CCR4 receptor. CKLF1-C27 shows great effect on...

Anpocogin

Reference: HY-P4150

€0.00 (tax incl.)

Anpocogin is the Ancyclostoma canium nematode anticoagulant protein c2, variant (C-terminal P85 added). Anpocogin, produced in Pichia pastoris, serves as an anticoagulant agent.

Cys-Gly-Lys-Lys-Gly-Amyloid β-Protein (36-42)

Reference: HY-P3780

€0.00 (tax incl.)

Cys-Gly-Lys-Lys-Gly-Amyloid β-Protein (36-42) is the 36-42 fragment of Amyloid β-Protein. β-amyloid, a polypeptide made up of 36-43 amino acids, is the main component of amyloid plaques found in the brains of people...

N-[(1,1-Dimethylethoxy)carbonyl]-L-leucyl-L-leucine

Reference: HY-78008

€0.00 (tax incl.)

N-[(1,1-Dimethylethoxy)carbonyl]-L-leucyl-L-leucine is a leucine derivative.

Auriculin A

Reference: HY-P3765

€0.00 (tax incl.)

Auriculin A is a synthetic atrial natriuretic factor (ANF) with hemodynamic effect. Auriculin A antagonizes renal vasoconstriction in the dog, and influences on arterial baroreflex control of heart rate, systemic...

DA-JC4

Reference: HY-P3255

€0.00 (tax incl.)

DA-JC4 is a dual GLP-1/GIP receptor agonist and can be used for the research of neurological disease and insulin signaling pathways.

N-(((9H-Fluoren-9-yl)methoxy)carbonyl)-S-methyl-L-cysteine

Reference: HY-W048708

€0.00 (tax incl.)

N-(((9H-Fluoren-9-yl)methoxy)carbonyl)-S-methyl-L-cysteine is a cysteine derivative.

Fmoc-Ile-OH

Reference: HY-19821

€0.00 (tax incl.)

Fmoc-Ile-OH is an isoleucine derivative.

Sincalide ammonium

Reference: HY-P0093A

€0.00 (tax incl.)

Sincalide ammonium (Cholecystokinin octapeptide ammonium, CCK-8 ammonium) is a rapid-acting amino acid polypeptide hormone analogue of cholecystokinin (CCK) for intravenous use in postevacuation cholecystography....

Cyclo(-RGDfK)

Reference: HY-P0023

€0.00 (tax incl.)

Cyclo(-RGDfK) is a potent and selective inhibitor of the αvβ3 integrin, with an IC50 of 0.94 nM. Cyclo(-RGDfK) TFA potently targets tumor microvasculature and cancer cells through the specific binding to the αvβ3...

HPV16 E7 (86-93)

Reference: HY-P1778

€0.00 (tax incl.)

HPV16 E7 (86-93) is a human leukocyte antigen (HLA)-A2.1 restricted HPV16 E7-derived peptide. HPV16 E7 (86-93) is immunogenic in cervical carcinomas.

Trilysine

Reference: HY-W009004

€0.00 (tax incl.)

Trilysine is sourced from L-lysine .

Gap 26 TFA

Reference: HY-P1082A

€0.00 (tax incl.)

Gap 26 TFA is a connexin mimetic peptide, composed of residue numbers 63-75 of the first extracellular loop of connexin 43 (gap junction blocker), containing the SHVR amino acid motif.

Cys-Kemptide

Reference: HY-P3920

€0.00 (tax incl.)

Cys-Kemptide is a cysteine-terminated substrate peptide that can used to measure protein kinase A (PKA) activity.

C3bot(154-182) TFA

Reference: HY-P1243A

€0.00 (tax incl.)

C3bot(154-182) TFA is a C3 peptide enhances recovery from spinal cord injury by improving regenerative growth of descending fiber tracts. C3bot(154-182) TFA represents a promising tool to foster axonal protection...

Tyr-Somatostatin-14

Reference: HY-P1600

€0.00 (tax incl.)

Tyr-Somatostatin-14 is a customized peptide that adds a Tyrosine amino acid to Somatostatin-14.

H-allo-Thr(tBu)-OH

Reference: HY-W051351

€0.00 (tax incl.)

H-allo-Thr(tBu)-OH is a threonine derivative.

Substance P

Reference: HY-P0201

€0.00 (tax incl.)

Substance P (Neurokinin P) is a neuropeptide, acting as a neurotransmitter and as a neuromodulator in the CNS. The endogenous receptor for substance P is neurokinin 1 receptor (NK1-receptor, NK1R).

H-Cys(Bzl)-OH

Reference: HY-W014329

€0.00 (tax incl.)

H-Cys(Bzl)-OH is a cysteine derivative.

TAT-NSF222 Fusion Peptide

Reference: HY-P4110

€0.00 (tax incl.)

TAT-NSF222 Fusion Peptide is a fusion polypeptide with two domains, a TAT domain, which enters cells through macropinocytosis, and an NSF domain that inhibits N-ethylmaleimide-sensitive factor (NSF). TAT-NSF222 Fusion...

Fmoc-Ala-Glu-Asn-Lys-NH2

Reference: HY-114174

€0.00 (tax incl.)

Fmoc-Ala-Glu-Asn-Lys-NH2 is a selective asparagine endopeptidase (AEP) inhibitor peptide and suppresses amyloid precursor protein (APP) cleavage. AEP, a pH-controlled cysteine proteinase, is activated during ageing...

VSGLNPSLWSIFGLQFILLWLVSGSRHYLW

Reference: HY-P3431

€0.00 (tax incl.)

VSGLNPSLWSIFGLQFILLWLVSGSRHYLW is a 30-amino-acid peptide mimicking the C-terminal domain of α2δ-1, termed as α2δ-1Tat peptide. VSGLNPSLWSIFGLQFILLWLVSGSRHYLW can effectively interrupt the α2δ-1 - NMDAR interaction in...

Fmoc-Ser(tBu)-Thr(psi(Me,Me)pro)-OH

Reference: HY-P2394

€0.00 (tax incl.)

Fmoc-Ser(tBu)-Thr(psi(Me,Me)pro)-OH is a dipeptide.

NH2-c[X-R-L-S-X]-K-G-P-(D-2Nal)

Reference: HY-P3347

€0.00 (tax incl.)

NH2-c[X-R-L-S-X]-K-G-P-(D-2Nal) (compound 40), a macrocyclic analogue of Ape13, is a potent APJ agonist (Ki=5.7 nM). NH2-c[X-R-L-S-X]-K-G-P-(D-2Nal) exhibits a favorable Gα12-biased signaling and an increased in vivo...

Amylin (IAPP), feline

Reference: HY-P1871

€0.00 (tax incl.)

Amylin (IAPP), feline is a 37-amino acid polypeptide from feline. Amylin (IAPP), feline is one of the major secretory products of β-cells of the pancreatic islets. Amylin (IAPP), feline is a regulatory peptide, which...

Disitertide TFA

Reference: HY-P0118A

€0.00 (tax incl.)

Disitertide (P144) TFA is a peptidic transforming growth factor-beta 1 (TGF-β1) inhibitor specifically designed to block the interaction with its receptor. Disitertide TFA is also a PI3K inhibitor and an apoptosis...

AMY-101

Reference: HY-P1717

€0.00 (tax incl.)

AMY-101 (Cp40), a peptidic inhibitor of the central complement component C3 (KD = 0.5 nM), inhibits naturally occurring periodontitis in non-human primates (NHPs). AMY-101 (Cp40) exhibits a favorable anti-inflammatory...

Dalazatide TFA

Reference: HY-P3507A

€0.00 (tax incl.)

Dalazatide (ShK-186) TFA is a specific Kv1.3 potassium channel peptide inhibitor. Dalazatide TFA can be used in the study of autoimmune diseases such as multiple sclerosis (MS), lupus erythematosus, psoriasis,...

Pinealon

Reference: HY-P4052

€0.00 (tax incl.)

Pinealon is a 3-amino acid peptide and shows neuroprotective properties. Pinealon prevents reactive oxygenspecies (ROS) accumulation and supressesthe activation of ERK 1/2. Pinealon has the ability to stimulate the...

AC 187

Reference: HY-P1393

€0.00 (tax incl.)

AC 187 is a potent and orally active amylin receptor antagonist with an IC50 of 0.48 nM and a Ki of 0.275 nM. AC 187 shows more selective for amylin receptor than calcitonin and CGRP receptors. AC 187 has...

Contulakin G

Reference: HY-P0066

€0.00 (tax incl.)

Contulakin G is an O-glycosylated invertebrate neurotensin. Contulakin-G is a weaker agonist for the neurotensin receptor. Contulakin G is also a potent antinociceptive agent.

Lecirelin

Reference: HY-P0051

€0.00 (tax incl.)

Lecirelin, a synthetic gonadotropin-releasing hormone (GnRH) analogue, acts as a GnRH agonist. Lecirelin is widely used for the research of bovine ovarian follicular cysts.

Ac-Nle-Pro-Nle-Asp-AMC

Reference: HY-P2016

€0.00 (tax incl.)

Ac-Nle-Pro-Nle-Asp-AMC is a specific substrate for 26S proteasome. Ac-Nle-Pro-Nle-Asp-AMC can be used for the 26S proteasome caspase-like activity analysis.

(S)-(+)-2-Phenylglycine methyl ester hydrochloride

Reference: HY-W019714

€0.00 (tax incl.)

(S)-(+)-2-Phenylglycine methyl ester hydrochloride is a Glycine (HY-Y0966) derivative.

N-Formyl-Met-Leu-Phe-Lys

Reference: HY-P1744

€0.00 (tax incl.)

N-Formyl-Met-Leu-Phe-Lys (fMLFK) is a peptide, acts as a potent and selective agonist of FPR1, with EC50s of 3.5 nM, 6.7 μM and 0.88 μM for FPR1, FPR2 and FPR2-D2817.32G, respectively.

TfR-T12

Reference: HY-P2297

€0.00 (tax incl.)

TfR-T12 is a BBB-penetrated transferrin receptor (TfR) binding peptide, displaying a binding affinity in the nM range.

Influenza NP (147-155)

Reference: HY-P1762

€0.00 (tax incl.)

Influenza NP (147-155) is a Kd restricted epitope from influenza nucleoprotein.

Eptifibatide monoacetate

Reference: HY-B0686A

€0.00 (tax incl.)

Eptifibatide monoacetate is a cyclic heptapeptide, acts as a competitive antagonist for the activated platelet glycoprotein IIb/IIIa receptor, with anti-platelet activity.

NLS-StAx-h

Reference: HY-P2272

€0.00 (tax incl.)

NLS-StAx-h is a selective, cell permeable, stapled peptide Wnt signaling inhibitor with an IC50 of 1.4 μM. NLS-StAx-h efficiently inhibits β-catenin-transcription factor interactions. NLS-StAx-h shows...

740 Y-P TFA

Reference: HY-P0175A

€0.00 (tax incl.)

740 Y-P TFA is a potent and cell-permeable PI3K activator. 740 Y-P TFA readily binds GST fusion proteins containing both the N- and C- terminal SH2 domains of p85 but fails to bind GST alone.

HAEGTFT

Reference: HY-P1228

€0.00 (tax incl.)

HAEGTFT is the first N-terminal 1-7 residues of GLP-1 peptide.

Fmoc-D-Asp(OtBu)-OH

Reference: HY-W013144

€0.00 (tax incl.)

Fmoc-D-Asp(OtBu)-OH is an aspartic acid derivative.

DX600 TFA

Reference: HY-P2222

€0.00 (tax incl.)

DX600 TFA is an ACE2 specific inhibitor, and do not cross-react with ACE.

CGGRGD

Reference: HY-P2219

€0.00 (tax incl.)

CGGRGD, a RGD derivative with cysteine as its N-terminal, CGGRGD is synthesized via solid-phase peptide synthesis technique and the surface of PCL fibers is aminolysised by amino 2-cyanobenzothiazole followed by the...

ErbB-2-binding peptide

Reference: HY-P4082

€0.00 (tax incl.)

ErbB-2-binding peptide (HER2-binding peptide) is a tumor-binding peptide. ErbB-2-binding peptide has the potential for cancer research.

Human PD-L1 inhibitor III

Reference: HY-P2564

€0.00 (tax incl.)

Human PD-L1 inhibitor III is a human PD-L1 inhibitor.

Atosiban acetate

Reference: HY-17572A

€0.00 (tax incl.)

Atosiban acetate (RW22164 acetate;RWJ22164 acetate) is a nonapeptide competitive vasopressin/oxytocin receptor antagonist, and is a desamino-oxytocin analogue. Atosiban is the main tocolytic agent and has the...

K-(D-1-Nal)-FwLL-NH2 TFA

Reference: HY-P1432A

€0.00 (tax incl.)

K-(D-1-Nal)-FwLL-NH2 TFA is a high affinity and potent ghrelin receptor inverse agonist (Ki values are 4.9 and 31 nM in COS7 and HEK293T cells, respectively). K-(D-1-Nal)-FwLL-NH2 blocks ghrelin receptor-mediated Gq-...

Pasireotide pamoate

Reference: HY-108768

€0.00 (tax incl.)

Pasireotide (SOM230) pamoate, a long-acting cyclohexapeptide somatostatin analogue, can improve agonist activity at somatostatin receptors (subtypes sst1/2/3/4/5, pKi=8.2/9.0/9.1/

Ziconotide TFA

Reference: HY-P0062A

€0.00 (tax incl.)

Ziconotide TFA (SNX-111 TFA), a peptide, is a potent and selective block of N-type calcium channels antagonist. Ziconotide TFA reduces synaptic transmission, and can be used for chronic pain research.

N-Acetyl-DL-serine

Reference: HY-W142092

€0.00 (tax incl.)

N-Acetyl-DL-serine is a hydrophobic amino acid that is synthesized in the body and can be found as a free form or as a salt with malonate, phosphate, or acetate. N-Acetyl-DL-serine has antimicrobial activity against...

Gly-Phe-Arg

Reference: HY-P0296

€0.00 (tax incl.)

Gly-Phe-Arg is a superpotent synthetic tripeptide mimics of the mud-crab pumping pheromone.

Lauryl-LF 11

Reference: HY-P1062

€0.00 (tax incl.)

Lauryl-LF 11, N-terminally acylated analogue of LF11, is a peptide with antibacterial activity.

Nonapeptide-1

Reference: HY-P0097

€0.00 (tax incl.)

Nonapeptide-1 (Melanostatine-5), a peptide hormone, is a selective antagonist of MC1R (Ki: 40 nM). Nonapeptide-1 is a competitive α-MSH antagonist that potently inhibits intracellular cAMP and melanosome dispersion...

Acetyl-(D-Arg2)-GRF (1-29) amide (human)

Reference: HY-P4750

€0.00 (tax incl.)

Acetyl-(D-Arg2)-GRF (1-29) amide (human) is an antagonist of growth hormone releasing factor (GRF). Acetyl-(D-Arg2)-GRF (1-29) amide (human) inhibits the release of growth hormone (GH) and can be used for endocrine...

JKC363

Reference: HY-P1213

€0.00 (tax incl.)

JKC363, a selective melanocortin MC4 receptor antagonist, has a 90-fold higher affinity at the MC4 receptor (IC50=0.5 nM) than at the MC3 receptor (44.9 nM). JKC-363 blocks the stimulatory effect of α-MSH on TRH...

Huwentoxin XVI

Reference: HY-P1078

€0.00 (tax incl.)

Huwentoxin XVI, an analgesic, is a highly reversible and selective mammalian N-type calcium channel (IC50 of ~60 nM) antagonist from Chinese tarantula Ornithoctonus huwena. Huwentoxin XVI has no effect on voltagegated...

[MePhe8,Sar9] Substance P

Reference: HY-P3927

€0.00 (tax incl.)

[MePhe8,Sar9] Substance P ([MePhe8-MeGly9] Substance P) is an analog of Substance P (Substance P (HY-P0201)).Substance P is a neuropeptide, acting as a neurotransmitter and as a neuromodulator in the CNS.

TRV120056

Reference: HY-P2382

€0.00 (tax incl.)

TRV120056 is a Gq-biased agonists, exhibits 10-fold larger molecular efficacies at the AT1R-Gq fusion protein compared with the AT1R-βarr2 fusion protein.

His-Pro hydrochloride

Reference: HY-111659A

€0.00 (tax incl.)

His-Pro hydrochloride is a dipeptide consisting of histidyl and proline.

Parasin I

Reference: HY-P0324

€0.00 (tax incl.)

Parasin I is a 19-amino acid histone H2A-derived peptide isolated from the skin of the catfish, and shows antimicrobial activity.

O-tert-Butyl-N-carbobenzoxy-L-serine methyl ester

Reference: HY-W011354

€0.00 (tax incl.)

O-tert-Butyl-N-carbobenzoxy-L-serine methyl ester is a serine derivative.

Fmoc-D-Lys(Aloc)-OH

Reference: HY-W041986

€0.00 (tax incl.)

Fmoc-D-Lys(Aloc)-OH is a lysine derivative.

[Sar9] Substance P

Reference: HY-P1738

€0.00 (tax incl.)

[Sar9] Substance P is a potent and selective neurokinin (NK)-1 receptor agonist.

BA 1

Reference: HY-P1423

€0.00 (tax incl.)

BA 1 is a potent agonist for the bombesin (BB) family of receptors. BA 1 binds with high affinity to Bombesin receptor subtype-3 (BRS3), gastrin releasing peptide receptor (GRPR), neuromedin B receptor (NMBR) with...

(R)-2-(((Benzyloxy)carbonyl)amino)-3,3-dimethylbutanoic acid

Reference: HY-77630

€0.00 (tax incl.)

(R)-2-(((Benzyloxy)carbonyl)amino)-3,3-dimethylbutanoic acid is a leucine derivative.

N-Chloroacetyl-DL-alanine

Reference: HY-W141835

€0.00 (tax incl.)

N-Chloroacetyl-DL-alanine is an alanine derivative.

GR 94800

Reference: HY-P1277

€0.00 (tax incl.)

GR 94800 is a potent and selective NK2 receptor peptide antagonist, with pKB values of 9.6, 6.4 and 6.0 for NK2, NK1 and NK3 receptors, respectively.

Fmoc-D-1-Nal-OH

Reference: HY-W013735

€0.00 (tax incl.)

Fmoc-D-1-Nal-OH is an alanine derivative.

SMAP-29

Reference: HY-P2460

€0.00 (tax incl.)

SMAP-29, a promising antiinfective agent, is a broad spectrum antibacterial and antifungal α-helical cathelicidin-derived peptide. SMAP-29 acts by permeabilizing bacterial membranes and inducing remarkable changes in...

Laminin (925-933)(TFA)

Reference: HY-P0131A

€0.00 (tax incl.)

Laminin (925-933) (TFA) is a peptide derived from residues 925-933 of the Laminin B1 chain that binds to the laminin receptor.

Orexin B, human

Reference: HY-P1339

€0.00 (tax incl.)

Orexin B, human is an endogenous agonist at Orexin receptor with Kis of 420 and 36 nM for OX1 and OX2, respectively.

Methyl N-methylglycinate hydrochloride

Reference: HY-Y1661

€0.00 (tax incl.)

Methyl N-methylglycinate hydrochloride is a Glycine (HY-Y0966) derivative.

EPO mimetic peptide-1

Reference: HY-P3756

€0.00 (tax incl.)

EPO mimetic peptide-1 (EMP-1), a 20 amino acid peptide. EPO mimetic peptide-1 stimulates cell proliferation, affects cell cycle and induces the production of reticulocytes in vivo.

Compstatin control peptide TFA

Reference: HY-P1398A

€0.00 (tax incl.)

Compstatin control peptide TFA is a negative control of Compstatin (HY-P1036). Compstatin is a potent complement system C3 inhibitor.

Phytochelatin 6 TFA

Reference: HY-P3323A

€0.00 (tax incl.)

Phytochelatin 6 TFA is metal-binding compound produced by plants. Phytochelatin 6 TFA may reduce bioavailability of dietary toxic metals such as cadmium.

Angiopeptin

Reference: HY-P2090

€0.00 (tax incl.)

Angiopeptin, a cyclic octapeptide analogue of somatostatin, is a weak sst2/sst5 receptor partial agonist with IC50 values of 0.26 nM and 6.92 nM, respectively. Angiopeptin is a potent inhibitor of growth hormone...

HIV p17 Gag (77-85)

Reference: HY-P1757

€0.00 (tax incl.)

HIV p17 Gag (77-85) is an HLA-A*0201(A2)-restricted CTL epitope, used in the research of anti-HIV.

Category: Peptides

Menu

Settings