Category: Peptides

Filter By
CB1 Receptor (C-Term) Blocking Peptide CB1 Receptor (C-Term) Blocking Peptide

CB1 Receptor (C-Term) Blocking Peptide

Reference: 10006591-1
€0.00 (tax incl.)
Peptide Sequence: CB1 receptor (C-Term) amino acids 461-472 · To be used in conjunction with Cayman’s CB1 Receptor (C-Term) polyclonal antibody (Item No. 10006590) to block protein-antibody complex formation during...
S1P1 Blocking Peptide S1P1 Blocking Peptide

S1P1 Blocking Peptide

Reference: 10006616-1
€0.00 (tax incl.)
Peptide Sequence: human S1P1 protein amino acids 241-253 (ISKASRSSEKSLA) · To be used in conjunction with Cayman’s S1P1 polyclonal antibody (Catalog No. 10005228) to block protein-antibody complex formation during...
5-OxoETE Receptor Blocking Peptide 5-OxoETE Receptor Blocking Peptide

5-OxoETE Receptor Blocking Peptide

Reference: 10006618-1
€0.00 (tax incl.)
Peptide Sequence: human 5-OxoETE receptor C-terminal amino acids 408-423 (KVQGEVSLEKEGSSQG) · To be used in conjunction with Cayman’s 5-OxoETE Receptor polyclonal antibody (Catalog No. 100025) to block...
Serine Palmitoyltransferase Blocking Peptide Serine Palmitoyltransferase Blocking Peptide

Serine Palmitoyltransferase Blocking Peptide

Reference: 10006620-1
€0.00 (tax incl.)
Peptide Sequence: human serine palmitoyltransferase subunit SPT2 amino acids 548-562 · To be used in conjunction with Cayman’s SPT polyclonal antibody (Catalog No. 10005260) to block protein-antibody complex...
ChREBP Blocking Peptide ChREBP Blocking Peptide

ChREBP Blocking Peptide

Reference: 10006790-1
€0.00 (tax incl.)
Peptide Sequence: murine amino acids 715-735 · To be used in conjunction with Cayman’s ChREBP polyclonal antibody (Catalog No. 10006789) to block protein-antibody complex formation during immunochemical analysis of...
Sphingosine Kinase 1 Blocking Peptide Sphingosine Kinase 1 Blocking Peptide

Sphingosine Kinase 1 Blocking Peptide

Reference: 10006823-1
€0.00 (tax incl.)
Peptide Sequence: human SPHK1 amino acids 264-274 (DLESEKYRRLG) · To be used in conjunction with Cayman’s Sphingosine Kinase 1 polyclonal antibody (Item No. 10006822) to block protein-antibody complex formation...
LPA1 Blocking Peptide LPA1 Blocking Peptide

LPA1 Blocking Peptide

Reference: 10006984-1
€0.00 (tax incl.)
Peptide Sequence: human LPA1 amino acids 342-359 · To be used in conjunction with Cayman’s LPA1 polyclonal antibody (Catalog No. 10005280) to block protein-antibody complex formation during immunochemical analysis of...
CRTH2/DP2 Receptor (C-Term) Blocking Peptide CRTH2/DP2 Receptor (C-Term) Blocking Peptide

CRTH2/DP2 Receptor (C-Term) Blocking Peptide

Reference: 10007003-1
€0.00 (tax incl.)
Peptide Sequence: CRTH2/DP2 protein amino acids 378-395 · To be used in conjunction with Cayman’s CRTH2/DP2 Receptor (C-Term) polyclonal antibody (Catalog No. 10007002) to block protein-antibody complex formation...
PTEN Blocking Peptide PTEN Blocking Peptide

PTEN Blocking Peptide

Reference: 10007073-1
€0.00 (tax incl.)
Peptide Sequence: human PTEN amino acids 254-270 · To be used in conjunction with Cayman’s PTEN polyclonal antibody (Catalog No. 10005059) to block protein-antibody complex formation during immunochemical analysis of...
PCSK9 (human) Blocking Peptide PCSK9 (human) Blocking Peptide

PCSK9 (human) Blocking Peptide

Reference: 10007186-1
€0.00 (tax incl.)
Peptide Sequence: human PCSK9 amino acids (SRSGKRRGERMEA) · To be used in conjunction with Cayman’s PCSK9 (human) polyclonal antibody (Catalog No. 10007185) to block protein-antibody complex formation during...
Lysophospholipase D Blocking Peptide Lysophospholipase D Blocking Peptide

Lysophospholipase D Blocking Peptide

Reference: 10007193-1
€0.00 (tax incl.)
Peptide Sequence: rat lysoPLD amino acids 573-588 · To be used in conjunction with Cayman’s lysoPLD polyclonal antibody (Catalog No. 10005375) to block protein-antibody complex formation during immunochemical...
GPR40 Blocking Peptide GPR40 Blocking Peptide

GPR40 Blocking Peptide

Reference: 10007206-1
€0.00 (tax incl.)
Peptide Sequence: human GPR40 amino acids 210-222 · To be used in conjunction with Cayman’s GPR40 polyclonal antibody (Catalog No. 10007605) to block protein-antibody complex formation during immunochemical analysis...
PEPCK Blocking Peptide PEPCK Blocking Peptide

PEPCK Blocking Peptide

Reference: 10007475-1
€0.00 (tax incl.)
Peptide Sequence: PEPCK protein amino acids 5-17 · To be used in conjunction with Cayman’s PEPCK polyclonal antibody (Catalog No. 10004943) to block protein-antibody complex formation during immunochemical analysis...
GPR35 Blocking Peptide GPR35 Blocking Peptide

GPR35 Blocking Peptide

Reference: 10007661-1
€0.00 (tax incl.)
Peptide Sequence: human GPR35 · To be used in conjunction with Cayman’s GPR35 polyclonal antibody (Catalog No. 10007660) to block protein-antibody complex formation during immunochemical analysis of GPR35.
LDL Receptor Blocking Peptide LDL Receptor Blocking Peptide

LDL Receptor Blocking Peptide

Reference: 10007672-1
€0.00 (tax incl.)
To be used in conjunction with Cayman’s NPC1L1 Polyclonal Antibody (Item No. 100076655) to block protein-antibody complex formation during immunochemical analysis of NPC1L1
Serum Retinol Binding Protein 4 Blocking Peptide Serum Retinol Binding Protein 4 Blocking Peptide

Serum Retinol Binding Protein 4 Blocking Peptide

Reference: 10007682-1
€0.00 (tax incl.)
Peptide Sequence: human amino acids 28-37 · To be used in conjunction with Cayman’s sRBP4 Polyclonal Antibody (Catalog No. 10007681) to block protein-antibody complex formation during immunochemical analysis of sRBP4.
IGFBP5 Blocking Peptide IGFBP5 Blocking Peptide

IGFBP5 Blocking Peptide

Reference: 10008206-1
€0.00 (tax incl.)
Peptide Sequence: human amino acids 192-206 · To be used in conjunction with Cayman’s IGFBP5 Polyclonal Antibody (Catalog No. 10008207) to block protein-antibody complex formation during immunochemical analysis of...
Adipose Triglyceride Lipase Blocking Peptide Adipose Triglyceride Lipase Blocking Peptide

Adipose Triglyceride Lipase Blocking Peptide

Reference: 10008492-1
€0.00 (tax incl.)
Peptide Sequence: human ATGL protein amino acids 382-400 (KRKLGRHLPSRLPEQVELR) · To be used in conjunction with Cayman’s Adipose Triglyceride Lipase polyclonal antibody (Catalog No. 10006409) to block...
SREBP-2 Blocking Peptide SREBP-2 Blocking Peptide

SREBP-2 Blocking Peptide

Reference: 10009266-1
€0.00 (tax incl.)
Peptide Sequence: human SREBP-2 protein amino acids 455-469 (SPLLDDAKVKDEPDS) · To be used in conjunction with Cayman’s SREBP-2 polyclonal antibody (Catalog No. 10007663) to block protein-antibody complex formation...
LCAT Blocking Peptide LCAT Blocking Peptide

LCAT Blocking Peptide

Reference: 10009324-1
€0.00 (tax incl.)
Amino acids: Human LCAT protein amino acids 132-143 · To be used in conjunction with Cayman’s LCAT Polyclonal Antibody (Item No. 10009323) to block protein-antibody complex formation during immunochemical analysis of...
TP Receptor (human) Blocking Peptide TP Receptor (human) Blocking Peptide

TP Receptor (human) Blocking Peptide

Reference: 10009368-1
€0.00 (tax incl.)
Antigen: human TP receptor C-terminal amino acids 323-343 (LSTRPRSLSLQPQLTQRSGLQ) · Host: rabbit · Cross-reactivity: (+) human, murine, rat, and Cos-7 (African green monkey) TP receptor; other species not tested...
PCSK9 (mouse) Blocking Peptide PCSK9 (mouse) Blocking Peptide

PCSK9 (mouse) Blocking Peptide

Reference: 10009581-1
€0.00 (tax incl.)
Peptide Sequence: Mouse PCSK9 amino acids 152-163 (VFAQSIPWNLER) · To be used in conjunction with Cayman’s PCSK9 (mouse) Polyclonal Antibody (Item No. 10008811) to block protein-antibody complex formation during...
Cellular Retinol Binding Protein 7 Blocking Peptide Cellular Retinol Binding Protein 7 Blocking Peptide

Cellular Retinol Binding Protein 7 Blocking Peptide

Reference: 10010251-1
€0.00 (tax incl.)
Peptide Sequence: synthetic peptide from human cRBP7 amino acids 125-134 (QVCKQTFQRA) · To be used in conjunction with Cayman’s Cellular Retinol Binding Protein 7 polyclonal antibody (Catalog No. 10010251) to block...
EP4 Receptor (N-Term) Blocking Peptide EP4 Receptor (N-Term) Blocking Peptide

EP4 Receptor (N-Term) Blocking Peptide

Reference: 101780-200
€0.00 (tax incl.)
Peptide Sequence: human amino acids 1-23 (MSTPGVNSSASLSPDRLNSPVTI)(3164,3185,3186,2035) · To be used in conjunction with Cayman’s EP4 receptor polyclonal antiserum (Catalog No. 101770) to block protein-antibody...
GPR55 Blocking Peptide GPR55 Blocking Peptide

GPR55 Blocking Peptide

Reference: 10225-200
€0.00 (tax incl.)
To be used in conjunction with Cayman’s GPR55 Polyclonal Antibody to block protein-antibody complex formation during immunochemical analysis of GPR55 for WB
Prolyl-glycyl-proline Peptide Prolyl-glycyl-proline Peptide

Prolyl-glycyl-proline Peptide

Reference: 11188-25
€0.00 (tax incl.)
Peptide sequence: PGP • PGP is a tripeptide molecule and an established biomarker for COPD and CF. PGP functions as a neutrophil chemoattractant and is derived from the proteolytic cleavage of collagen in the...
Prolyl-glycyl-proline Peptide Prolyl-glycyl-proline Peptide

Prolyl-glycyl-proline Peptide

Reference: 11188-5
€0.00 (tax incl.)
Peptide sequence: PGP • PGP is a tripeptide molecule and an established biomarker for COPD and CF. PGP functions as a neutrophil chemoattractant and is derived from the proteolytic cleavage of collagen in the...
N-acetyl-Pro-Gly-Pro Peptide N-acetyl-Pro-Gly-Pro Peptide

N-acetyl-Pro-Gly-Pro Peptide

Reference: 11189-25
€0.00 (tax incl.)
Peptide sequence: N-terminal acetylated-PGP • N-acetyl-PGP is a tripeptide that functions as a neutrophil chemoattractant. N-acetyl-PGP and PGP induce the recruitment of neutrophils (PMN) through stimulation of...
N-acetyl-Pro-Gly-Pro Peptide N-acetyl-Pro-Gly-Pro Peptide

N-acetyl-Pro-Gly-Pro Peptide

Reference: 11189-5
€0.00 (tax incl.)
Peptide sequence: N-terminal acetylated-PGP • N-acetyl-PGP is a tripeptide that functions as a neutrophil chemoattractant. N-acetyl-PGP and PGP induce the recruitment of neutrophils (PMN) through stimulation of...
BLT1 Receptor Blocking Peptide BLT1 Receptor Blocking Peptide

BLT1 Receptor Blocking Peptide

Reference: 120112-200
€0.00 (tax incl.)
Peptide Sequence: human amino acids 331-352 (ALEPGPSESLTASSPLKLNELN)(4425) · To be used in conjunction with Cayman’s BLT1 receptor polyclonal antibodies (Catalog Nos. 100019 and 120114) to block protein-antibody...
PAF Receptor Blocking Peptide (Polyclonal) PAF Receptor Blocking Peptide (Polyclonal)

PAF Receptor Blocking Peptide (Polyclonal)

Reference: 160604-200
€0.00 (tax incl.)
To be used in conjunction with Cayman’s PAF receptor polyclonal antiserum (Catalog No. 160602) to block protein-antibody complex formation during analysis for the PAF receptor.
Caveolin 1/3 Blocking Peptide Caveolin 1/3 Blocking Peptide

Caveolin 1/3 Blocking Peptide

Reference: 300830-200
€0.00 (tax incl.)
Peptide Sequence: rat Cav-3 amino acids 19-41 (CKEIDLVNRDPKNINEDIVKVDF)(3942) · To be used in conjunction with Cayman’s caveolin 1/3 polyclonal antibody (Catalog No. 100830) to block protein-antibody complex...
Acridinium NHS ester Acridinium NHS ester

Acridinium NHS ester

Reference: 200200-1
€0.00 (tax incl.)
The acridinium NHS ester can be used to label proteins and nucleic acids. The covalently bound acridinium NHS ester will produce chemiluminescence in the presence of hydrogen peroxide. Acridinium-labeled proteins can...
Acridinium NHS ester Acridinium NHS ester

Acridinium NHS ester

Reference: 200200-10
€0.00 (tax incl.)
The acridinium NHS ester can be used to label proteins and nucleic acids. The covalently bound acridinium NHS ester will produce chemiluminescence in the presence of hydrogen peroxide. Acridinium-labeled proteins can...
Acridinium NHS ester Acridinium NHS ester

Acridinium NHS ester

Reference: 200200-5
€0.00 (tax incl.)
The acridinium NHS ester can be used to label proteins and nucleic acids. The covalently bound acridinium NHS ester will produce chemiluminescence in the presence of hydrogen peroxide. Acridinium-labeled proteins can...
Acridinium NHS ester Acridinium NHS ester

Acridinium NHS ester

Reference: 200200-50
€0.00 (tax incl.)
The acridinium NHS ester can be used to label proteins and nucleic acids. The covalently bound acridinium NHS ester will produce chemiluminescence in the presence of hydrogen peroxide. Acridinium-labeled proteins can...
27-alkyne Cholesterol 27-alkyne Cholesterol

27-alkyne Cholesterol

Reference: 24319-100
€0.00 (tax incl.)
An alkyne derivative of cholesterol for click chemistry; has been used to track cholesterol metabolism and localization
27-alkyne Cholesterol 27-alkyne Cholesterol

27-alkyne Cholesterol

Reference: 24319-250
€0.00 (tax incl.)
An alkyne derivative of cholesterol for click chemistry; has been used to track cholesterol metabolism and localization
27-alkyne Cholesterol 27-alkyne Cholesterol

27-alkyne Cholesterol

Reference: 24319-500
€0.00 (tax incl.)
An alkyne derivative of cholesterol for click chemistry; has been used to track cholesterol metabolism and localization
BODIPY-Cholesterol BODIPY-Cholesterol

BODIPY-Cholesterol

Reference: 24618-1
€0.00 (tax incl.)
A fluorescently-tagged cholesterol; co-localizes with dehydroergosterol in HeLa cells and is trafficked from the plasma membrane to the endocytic recycling compartment in BHK cells; ex/em = 480/508 nm, respectively;...
BODIPY-Cholesterol BODIPY-Cholesterol

BODIPY-Cholesterol

Reference: 24618-10
€0.00 (tax incl.)
A fluorescently-tagged cholesterol; co-localizes with dehydroergosterol in HeLa cells and is trafficked from the plasma membrane to the endocytic recycling compartment in BHK cells; ex/em = 480/508 nm, respectively;...
BODIPY-Cholesterol BODIPY-Cholesterol

BODIPY-Cholesterol

Reference: 24618-5
€0.00 (tax incl.)
A fluorescently-tagged cholesterol; co-localizes with dehydroergosterol in HeLa cells and is trafficked from the plasma membrane to the endocytic recycling compartment in BHK cells; ex/em = 480/508 nm, respectively;...
BODIPY-Cholesterol BODIPY-Cholesterol

BODIPY-Cholesterol

Reference: 24618-500
€0.00 (tax incl.)
A fluorescently-tagged cholesterol; co-localizes with dehydroergosterol in HeLa cells and is trafficked from the plasma membrane to the endocytic recycling compartment in BHK cells; ex/em = 480/508 nm, respectively;...
SureLight® 488 NHS ester SureLight® 488 NHS ester

SureLight® 488 NHS ester

Reference: 27091-1
€0.00 (tax incl.)
SureLight® 488 is a bright green fluorescent dye with excitation suited to the 488 nm laser line, fluorescent microscopy, and flow cytometry. The NHS ester version is an efficient amine reactive probe that can be used...
SureLight® 488 NHS ester SureLight® 488 NHS ester

SureLight® 488 NHS ester

Reference: 27091-100
€0.00 (tax incl.)
SureLight® 488 is a bright green fluorescent dye with excitation suited to the 488 nm laser line, fluorescent microscopy, and flow cytometry. The NHS ester version is an efficient amine reactive probe that can be used...
N-α-Benzoyl-L-Arginine ethyl ester (hydrochloride) N-α-Benzoyl-L-Arginine ethyl ester (hydrochloride)

N-α-Benzoyl-L-Arginine ethyl ester (hydrochloride)

Reference: 27183-10
€0.00 (tax incl.)
A nonpeptide substrate of proteases and deiminases; has been used as a substrate for the relative quantification of trypsin activity; has also been used as a substrate for the activity of subtilisins, kallikreins, and...
N-α-Benzoyl-L-Arginine ethyl ester (hydrochloride) N-α-Benzoyl-L-Arginine ethyl ester (hydrochloride)

N-α-Benzoyl-L-Arginine ethyl ester (hydrochloride)

Reference: 27183-5
€0.00 (tax incl.)
A nonpeptide substrate of proteases and deiminases; has been used as a substrate for the relative quantification of trypsin activity; has also been used as a substrate for the activity of subtilisins, kallikreins, and...
N-α-Benzoyl-L-Arginine ethyl ester (hydrochloride) N-α-Benzoyl-L-Arginine ethyl ester (hydrochloride)

N-α-Benzoyl-L-Arginine ethyl ester (hydrochloride)

Reference: 27183-50
€0.00 (tax incl.)
A nonpeptide substrate of proteases and deiminases; has been used as a substrate for the relative quantification of trypsin activity; has also been used as a substrate for the activity of subtilisins, kallikreins, and...
Biotin-Amyloid-β (1-40) Peptide (trifluoroacetate salt) Biotin-Amyloid-β (1-40) Peptide (trifluoroacetate salt)

Biotin-Amyloid-β (1-40) Peptide (trifluoroacetate salt)

Reference: 27411-500
€0.00 (tax incl.)
An affinity probe for Aβ40 binding partners; has been used to characterize Aβ40 distribution amongst the lipoprotein fractions and identify Aβ40 interaction partners in human plasma,
Histone H1-derived Peptide (trifluoroacetate salt) Histone H1-derived Peptide (trifluoroacetate salt)

Histone H1-derived Peptide (trifluoroacetate salt)

Reference: 27439-1
€0.00 (tax incl.)
A peptide substrate for CRK3/CYC6; phosphorylated by CRK3/CYC6 and has been used in high-throughput screening assays for the identification of CRK3/CYC6 inhibitors
BODIPY 630/650X succinimide ester BODIPY 630/650X succinimide ester

BODIPY 630/650X succinimide ester

Reference: 27758-1
€0.00 (tax incl.)
An amine-reactive fluorescent probe; has been used, linked to adenosine A1 receptor ligands, as a fluorescent probe to quantify ligand-receptor binding; ex/em = 630/650 nm, respectively
BODIPY 630/650X succinimide ester BODIPY 630/650X succinimide ester

BODIPY 630/650X succinimide ester

Reference: 27758-5
€0.00 (tax incl.)
An amine-reactive fluorescent probe; has been used, linked to adenosine A1 receptor ligands, as a fluorescent probe to quantify ligand-receptor binding; ex/em = 630/650 nm, respectively
Optineurin (C-Term) Blocking Peptide Optineurin (C-Term) Blocking Peptide

Optineurin (C-Term) Blocking Peptide

Reference: 300000-1
€0.00 (tax incl.)
The peptide is identical among human, mous, and rat optineurin, amino acids 559-575 (GEVLPDIDTLQIHVMDC). This blocking peptide can be used in conjunction with Cayman’s Optineurin (C-Term) Polyclonal Antibody (Catalog...
Optineurin (INT) Blocking Peptide Optineurin (INT) Blocking Peptide

Optineurin (INT) Blocking Peptide

Reference: 300002-1
€0.00 (tax incl.)
Peptide Sequence: human optineurin amino acids 115-130 (KGKSERSSEDPTDDSR) · To be used in conjunction with Cayman’s optineurin (INT) polyclonal antibody (Catalog No. 100002) to block protein-antibody complex...
HIF-1α (C-Term) Blocking Peptide HIF-1α (C-Term) Blocking Peptide

HIF-1α (C-Term) Blocking Peptide

Reference: 300003-1
€0.00 (tax incl.)
Peptide Sequence: HIF-1α protein amino acids (SRNLLQGEELLRALDQVN) · To be used in conjunction with Cayman’s HIF-1α Polyclonal Antibody (Item No. 10006421) to block protein-antibody complex formation during...
CD36 Blocking Peptide CD36 Blocking Peptide

CD36 Blocking Peptide

Reference: 300011-1
€0.00 (tax incl.)
Peptide Sequence: human CD36 sequence amino acids 98-114 (AKENVTQDAEDNTVSF) · To be used in conjunction with Cayman’s CD36 polyclonal antibody (Catalog No. 100011) to block protein-antibody complex formation during...
Prostaglandin E Synthase-2 (microsomal) Blocking Peptide Prostaglandin E Synthase-2 (microsomal) Blocking Peptide

Prostaglandin E Synthase-2 (microsomal) Blocking Peptide

Reference: 300012-1
€0.00 (tax incl.)
Peptide Sequence: amino acids 221-235 (VYGGKEARTEEMKWR) · To be used in conjunction with Cayman’s mPGE synthase-2 polyclonal antibody (Catalog No. 160145) to block protein-antibody complex formation during analysis...
β-Catenin Blocking Peptide β-Catenin Blocking Peptide

β-Catenin Blocking Peptide

Reference: 300013-1
€0.00 (tax incl.)
Peptide Sequence: human β-catenin amino acids 43-62 (APSLSGKGNPEEEDVDTSQV) · To be used in conjunction with Cayman’s β-catenin polyclonal antibody (Catalog No. 100029) to block protein-antibody complex formation...
Monoacylglycerol Lipase Blocking Peptide Monoacylglycerol Lipase Blocking Peptide

Monoacylglycerol Lipase Blocking Peptide

Reference: 300014-1
€0.00 (tax incl.)
Peptide Sequence: human monoacylglycerol lipase blocking peptide amino acids 1-14 (MPEESSPRRTPQSI) · To be used in conjunction with Cayman’s Monoacylglycerol Lipase Polyclonal Antibody (Item No. 100035) to block...
CB2 Receptor Blocking Peptide CB2 Receptor Blocking Peptide

CB2 Receptor Blocking Peptide

Reference: 301550-200
€0.00 (tax incl.)
Peptide Sequence: human CB2 receptor sequence amino acids 20-33 (NPMKDYMILSGPQK)(6724) · To be used in conjunction with Cayman’s CB2 receptor polyclonal antibody (Catalog No. 101550) to block protein-antibody complex...
Fatty Acid Amide Hydrolase Blocking Peptide Fatty Acid Amide Hydrolase Blocking Peptide

Fatty Acid Amide Hydrolase Blocking Peptide

Reference: 301600-1
€0.00 (tax incl.)
Peptide Sequence: rat FAAH amino acids sequence 561-579 (CLRFMREVEQLMTPQKQPS)(9140) · To be used in conjunction with Cayman’s FAAH polyclonal antibody (Catalog No. 101600) to block protein-antibody complex formation...
DP1 Receptor Blocking Peptide DP1 Receptor Blocking Peptide

DP1 Receptor Blocking Peptide

Reference: 301640-1
€0.00 (tax incl.)
To be used in conjunction with Cayman’s DP1 Receptor Polyclonal Antibody (Catalog No. 101640) to block protein-antibody complex formation during immunochemical analysis of the DP1 receptor.
PPARγ Blocking Peptide PPARγ Blocking Peptide

PPARγ Blocking Peptide

Reference: 301700-1
€0.00 (tax incl.)
Peptide Sequence: human PPARγ1 amino acids 82-101 (PASPPYYSEKTQLYNKPHEE; amino acids 110-129 of PPARγ2) · To be used in conjunction with Cayman’s PPARγ polyclonal antibody (Catalog No. 101700) to block...
PPARα Blocking Peptide PPARα Blocking Peptide

PPARα Blocking Peptide

Reference: 301710-1
€0.00 (tax incl.)
Peptide sequence: human PPARα amino acids 22-36 (PLSEEFLQEMGNIQE)(6160) · To be used in conjunction with Cayman’s PPARα polyclonal antibody (Item No. 101710) to block protein-antibody complex formation during analysis...
EP1 Receptor Blocking Peptide EP1 Receptor Blocking Peptide

EP1 Receptor Blocking Peptide

Reference: 301740-1
€0.00 (tax incl.)
Peptide Sequence: human EP1 receptor C-terminal amino acids 380-402 (GLTPSAWEASSLRSSRHSGLSHF)(3176) · To be used in conjunction with Cayman’s EP1 receptor polyclonal antibody (Catalog No. 101740) to block...
EP2 Receptor Blocking Peptide EP2 Receptor Blocking Peptide

EP2 Receptor Blocking Peptide

Reference: 301750-200
€0.00 (tax incl.)
Peptide Sequence: human EP2 receptor amino acids 335-358 (SLRTQDATQTSCSTQSDASKQADL)(3178) · To be used in conjunction with Cayman’s EP2 receptor polyclonal antibody (Catalog No. 101750) to block protein-antibody...
EP3 Receptor Blocking Peptide EP3 Receptor Blocking Peptide

EP3 Receptor Blocking Peptide

Reference: 301760-1
€0.00 (tax incl.)
Peptide Sequence: human EP3 receptor sequence amino acids 308-327 (NQTSVEHCKTHTEKQKECNF)(3180,1900) · To be used in conjunction with Cayman’s EP3 receptor polyclonal antibody (Catalog No. 101760) to block...
EP4 Receptor (C-Term) Blocking Peptide EP4 Receptor (C-Term) Blocking Peptide

EP4 Receptor (C-Term) Blocking Peptide

Reference: 301775-200
€0.00 (tax incl.)
Peptide Sequence: human EP4 receptor sequence amino acids 459-488 (GSGRAGPAPKGSSLQVTFPSETLNLSEKCI)(3164,3186) · To be used in conjunction with Cayman’s EP4 receptor polyclonal antibody (Catalog No. 101775) to block...
RICK Blocking Peptide RICK Blocking Peptide

RICK Blocking Peptide

Reference: 301785-200
€0.00 (tax incl.)
Peptide Sequence: human RICK sequence amino acids 11-30 (PTIPYHKLADLRYLSRGASG) · To be used in conjunction with Cayman’s RICK polyclonal antibody (Catalog No. 160785) to block protein-antibody complex formation...

Menu

Settings

Please sign in first.

Sign in