Proteins & Peptides

The Acetylated Histone H3 (K9, 14) Peptide sequence (ARTKQTAR[Ac-K]STGG[Ac-K]APRKQLAGGKKC) is derived from human histone H3 (1-21) and is suitable for use as the assay control of histone (de-)methylation and (de-)...

Acetylated Histone H4 Peptide I

Reference: H13-358-500

€0.00 (tax incl.)

The Acetylated Histone H4 (K5, 8, 12, 16) Peptide sequence (SGRG[Ac-K]GG[Ac-K]GLG[Ac-K]GGA[Ac-K]RHRKVGGKKC) is derived from human histone H4 (1-21) and is suitable for use as the assay control of histone...

AMARA Peptide

Reference: A11-58

€0.00 (tax incl.)

The AMARA substrate peptide sequence (AMARAASAAALARRR) is routinely evaluated as a substrate for SIK and AMPK.

Autocamtide 2

Reference: A15-58

€0.00 (tax incl.)

The Autocamtide 2 peptide sequence (KKALRRQETVDAL-amide) is based on the autophosphorylation site (amino acid 283-290) on CaMKII.

Axltide

Reference: A16-58

€0.00 (tax incl.)

The Axltide peptide sequence (KKSRGDYMTMQIG) is based on the mouse Insulin receptor substrate 1 (amino acid 979-989).

CATCHtide

Reference: C02-58

€0.00 (tax incl.)

The CATCHtide peptide sequence (CRRHYYYDTHTNTYY-LRTFGHNTRR) is derived from human SLC12A2 (amino acids 198-217) and is suitable as a substrate for kinases OSR1 and STK39.

CDKtide

Reference: C06-58

€0.00 (tax incl.)

The CDKtide peptide sequence (CKKKYSPTSPSYSPTSPSY-SPTSPS) is derived from the C-terminus of the largest subunit of human RNA polymerase II which has 52 approximate tandem repeats of 7 amino acids...

Chktide

Reference: C10-58

€0.00 (tax incl.)

The Chktide peptide sequence (KKKVSRSGLYRSPSMPENLNRPR) is based on the human CDC25C protein isoform A (amino acid 205-225).

CK1tide

Reference: C07-58-1

€0.00 (tax incl.)

The CK1tide synthetic peptide [HAAIGDDDDAYSITA-NH2] is routinely evaluated as a substrate for CK1 family kinases, such as CK1 and CK1 delta.

CREBtide

Reference: C50-58

€0.00 (tax incl.)

The CREBtide peptide sequence (KRREILSRRPSYR) is based on the human CREB1 isoform A (amino acid 109-121).

Crosstide

Reference: C51-58

€0.00 (tax incl.)

The Crosstide peptide sequence (GRPRTSSFAEG) is based on the GSK3.

CSKtide

Reference: C63-58

€0.00 (tax incl.)

The synthetic peptide CSKtide (KKKEEIYFFFG-NH2) contains a tyrosine protein kinase phosphorylation site and can be used for CSK and TNK1 assay.

DYRKtide

Reference: D96-58

€0.00 (tax incl.)

The synthetic peptide (RRRFRPASPLRGPPK) contains a serine/threonine protein kinase phosphorylation site and is routinely evaluated as a substrate for DYRK family kinases.

EF2tide

Reference: E01-58

€0.00 (tax incl.)

The EF2tide substrate peptide sequence (RKKFGESEKTKTKEFL) is based on dictyostelium myosin II heavy chain (amino acid 2020-2035).

EIF2S Peptide

Reference: E23-58

€0.00 (tax incl.)

The 13 amino acids of EIF2S peptide sequence (CILLSELSRRRIR) is derived from human protein EIF2S1 between residues 46-57. This peptide is suitable for use as a substrate for MNK1 and EIF2AK family kinases.

GRKtide

Reference: G46-58

€0.00 (tax incl.)

The synthetic peptide sequence (CRRREEEEESAAA) is routinely evaluated as a substrate for GRK family kinases, including GRK2, GRK3, GRK4 and GRK7.

GS Peptide

Reference: G60-58

€0.00 (tax incl.)

The GS peptide sequence (PLSRTLSVSS) is derived from an N-terminus of glycogen synthase and is suitable for use as the substrate for DCAMKL1 and CAMKII family.

Histone H1 Peptide

Reference: H10-58-1

€0.00 (tax incl.)

The Histone H1 Peptide (152-159) sequence (GGGPATP-KKAKKL-COOH) is derived from human histone H1 between amino acids 152-159 and is suitable for use as the substrate for CDK family kinase assays, such as CDK1, CDK2,...

Histone H3 Peptide (1-21)

Reference: H12-58-500

€0.00 (tax incl.)

The Histone H3 Peptide (1-21) sequence (ARTKQTARKS-TGGKAPRKQLAGGKKC) is derived from human histone H3 (1-21) and is suitable for use as the substrate for histone methyltransferase (at K4 and K9) and acetyltransferase...

Histone H3 Peptide (1-21)

Reference: H12-58-01

€0.00 (tax incl.)

The Histone H3 Peptide (1-21) sequence (ARTKQTARKS-TGGKAPRKQLAGGKKC) is derived from human histone H3 (1-21) and is suitable for use as the substrate for histone methyltransferase (at K4 and K9) and acetyltransferase...

Histone H4 Peptide (1-21)

Reference: H13-58-500

€0.00 (tax incl.)

The Histone H4 Peptide (1-21) sequence (SGRGKGGKGL-GKGGAKRHRKVGGKKC) is derived from human histone H4 (1-21) and is suitable for use as the substrate for histone methyltransferase (at R3) and acetyltransferase (at K5,...

Histone H4 Peptide (1-21)

Reference: H13-58-01

€0.00 (tax incl.)

The Histone H4 Peptide (1-21) sequence (SGRGKGGKGL-GKGGAKRHRKVGGKKC) is derived from human histone H4 (1-21) and is suitable for use as the substrate for histone methyltransferase (at R3) and acetyltransferase (at K5,...

HSP27tide

Reference: H31-58

€0.00 (tax incl.)

The HSP27tide peptide sequence (RRLNRQLSVA-amide) is based on the mouse HSP27 (amino acid 80-85).

IGF1Rtide

Reference: I15-58

€0.00 (tax incl.)

The 14 amino acids of IGF1Rtide peptide sequence (KKKSPGEYVNIEFG) is derived from human IRS-1 protein residues 891-902.

IKKtide

Reference: I33-58

€0.00 (tax incl.)

The IKKtide peptide sequence (KKKKERLLDDRHDSG-LDSMKDEE) is derived from human IkBA (amino acids 21-41) and is suitable as a substrate for IKK alpha and IKK beta.

IRS1 (Y608) Peptide

Reference: I40-58-1000

€0.00 (tax incl.)

The synthetic IRS1 (Y608) Peptide [KKHTDDGYMPMSPGVA] is derived from mouse insulin receptor substrate 1 (amino acids 603-616) and is suitable as substrate for JAK1 and JAK2.

JAK3tide

Reference: J03-58-1000

€0.00 (tax incl.)

The JAK3tide synthetic peptide [GGEEEEYFELVKKKK] is routinely evaluated as a substrate for JAK3 and JAK2.

LKBtide

Reference: L15-58

€0.00 (tax incl.)

The synthetic peptide LKBtide (LSNLYHQGKFLQTFCGSPLY-RRRC) is derived from human NUAK2 (amino acid 196-215) and can be phosphorylated by protein Serine/Threonine kinase 11 (STK11), also known as LKB1.

LRRKtide

Reference: L10-58

€0.00 (tax incl.)

The LRRKtide peptide sequence (RLGRDKYKTLRQIRQ) is derived from human ezrin (amino acids 561-573), moesin (amino acids 539-553) and radixin (amino acids 558-570) and is suitable for use as a substrate for LRRK kinases.

MARCKS Peptide

Reference: M02-58

€0.00 (tax incl.)

The synthetic peptide (KKRFSFKKSFKL) is derived from amino acid residues 154 –165 of protein myristoylated alanine-rich C-kinase substrate (MARCKS). This peptide is suitable for use as a substrate for PKC alpha, PKC...

Micro2 Peptide

Reference: M08-58-1000

€0.00 (tax incl.)

The Micro2 Peptide sequence (KEEQSQITSQVTGQIGWR) is derived from human AP-2 complex subunit mu isoform b (amino acids 143-160) and is suitable as a substrate for AAK1, BMP2K, and GAK kinase assay.

MLC Peptide

Reference: M09-58

€0.00 (tax incl.)

The MLC Peptide sequence (AKRPQRATSNVFS) represents the phosphate-accepting domain of human MYL9 (amino acids 12-23) and can be used as a substrate for PHKG1, PHKG2 and DAPK2.

Modified EIF2S Peptide

Reference: E23-58B

€0.00 (tax incl.)

The Modified EIF2S Peptide sequence (Modified-CILLSELSRRRIR) is derived from human EIF2S1 (46-57) and is suitable for use as the substrate for EIF2AK kinase family and MNK1.

Modified PLKtide

Reference: P41-58B

€0.00 (tax incl.)

The Modified PLKtide peptide sequence (Modified-CKKLGEDQAEEISDDLLEDSLSDEDE) is derived from the CDC25C protein sequence (182-204).

Modified SGKtide

Reference: S08-58B

€0.00 (tax incl.)

The Modified SGKtide peptide sequence (Modified- CKKRNRRLSVA) contains serine protein kinase phosphorylation site and is evaluated as a substrate for SGK and NDR family kinases.

MRCL3 Peptide

Reference: M56-58

€0.00 (tax incl.)

The synthetic substrate MRCL3 Peptide (KKRPQRATSN-VFAM-NH2) is derived from human myosin regulatory light chain MRCL3 (amino acid 11-24) and can be used for MLCK, MYLK2 and MYLK3 kinase assay.

PAKtide

Reference: P08-58

€0.00 (tax incl.)

The 10 amino acids of PAKtide peptide (RRRLSFAEPG) contain a serine/threonine protein kinase phosphorylation site in a common seven-residue epitope (1, 2).

PDHKtide

Reference: P57-58

€0.00 (tax incl.)

The synthetic peptide substrate PDHKtide (RRYHGHSMS-DPGVSYRTR) is derived from human PDHA1 protein (amino acid 288-304aa) and can be used for PDHK family kinase assay.

PDKtide

Reference: P10-58

€0.00 (tax incl.)

The 39 amino acids of PDKtide peptide sequence ([protein fragment, 39 aa]) is derived from two human proteins: residues 1-14 are based on AKT1 (307-320) and residues 16-39 are based on PKN2/PRK2 (961-984).

PKCtide

Reference: P15-58

€0.00 (tax incl.)

The PKCtide peptide sequence (ERMRPRKRQGSVRRRV) is based on protein kinase C epsilon (amino acid 149-164).

PLKtide

Reference: P41-58

€0.00 (tax incl.)

The PLKtide peptide sequence (CKKLGEDQAEEISDDLLED-SLSDEDE) is derived from the CDC25C protein sequence (182-204).

Poly (4:1 Glu, Tyr) Peptide

Reference: P61-58

€0.00 (tax incl.)

The Poly (4:1 Glu, Tyr) substrate peptide is used as universal substrate for protein tyrosine kinases.

Poly (6:2:5:1 Ala,Glu,Lys,Tyr) Peptide

Reference: P60-58

€0.00 (tax incl.)

The Poly (6:2:5:1 Ala,Glu,Lys,Tyr) substrate peptide is used as universal substrate for protein tyrosine kinases.

PS7-CTD Peptide

Reference: R06-58-

€0.00 (tax incl.)

The PS7-CTD peptide sequence (YSPTS PpSYSP TSPpS) is derived from C-terminal repeat domain of human RNA polymerase II.

RS Repeat Peptide

Reference: R55-58

€0.00 (tax incl.)

The synthetic peptide (GRSRSRSRSRSRSRSR) contains serine/threonine protein kinase phosphorylation sites and is routinely evaluated as a substrate for CLK, EIF2AK and SRPK family kinases.

SAMStide

Reference: S07-58

€0.00 (tax incl.)

The SAMStide peptide sequence (HMRSAMSGLHLVKRR) is based on the mouse acetyl-Coenzyme A carboxylase alpha (amino acid 73-85).

Category: Proteins & Peptides

Menu

Settings