Category: Proteins & Peptides

Filter By
Brand: AdipoGen Brand: Arigo Biolaboratoires Brand: Signalchem Clear all
CBX1 / HP1-Beta Peptide CBX1 / HP1-Beta Peptide

CBX1 / HP1-Beta Peptide

Reference: ARG56408
€0.00 (tax incl.)
This gene encodes a highly conserved nonhistone protein, which is a member of the heterochromatin protein family . The protein is enriched in the heterochromatin and associated with centromeres. The protein has a...
Abltide Abltide

Abltide

Reference: A02-58-1000
€0.00 (tax incl.)
The Abltide peptide sequence (EAIYAAPFAKKK) is based on the C-terminus of Abl.
Acetylated Histone H3 Peptide I Acetylated Histone H3 Peptide I

Acetylated Histone H3 Peptide I

Reference: H12-358-500
€0.00 (tax incl.)
The Acetylated Histone H3 (K9, 14) Peptide sequence (ARTKQTAR[Ac-K]STGG[Ac-K]APRKQLAGGKKC) is derived from human histone H3 (1-21) and is suitable for use as the assay control of histone (de-)methylation and (de-)...
Acetylated Histone H4 Peptide I Acetylated Histone H4 Peptide I

Acetylated Histone H4 Peptide I

Reference: H13-358-500
€0.00 (tax incl.)
The Acetylated Histone H4 (K5, 8, 12, 16) Peptide sequence (SGRG[Ac-K]GG[Ac-K]GLG[Ac-K]GGA[Ac-K]RHRKVGGKKC) is derived from human histone H4 (1-21) and is suitable for use as the assay control of histone...
AMARA Peptide AMARA Peptide

AMARA Peptide

Reference: A11-58
€0.00 (tax incl.)
The AMARA substrate peptide sequence (AMARAASAAALARRR) is routinely evaluated as a substrate for SIK and AMPK.
Autocamtide 2 Autocamtide 2

Autocamtide 2

Reference: A15-58
€0.00 (tax incl.)
The Autocamtide 2 peptide sequence (KKALRRQETVDAL-amide) is based on the autophosphorylation site (amino acid 283-290) on CaMKII.
Axltide Axltide

Axltide

Reference: A16-58
€0.00 (tax incl.)
The Axltide peptide sequence (KKSRGDYMTMQIG) is based on the mouse Insulin receptor substrate 1 (amino acid 979-989).
CATCHtide CATCHtide

CATCHtide

Reference: C02-58
€0.00 (tax incl.)
The CATCHtide peptide sequence (CRRHYYYDTHTNTYY-LRTFGHNTRR) is derived from human SLC12A2 (amino acids 198-217) and is suitable as a substrate for kinases OSR1 and STK39.
CDKtide CDKtide

CDKtide

Reference: C06-58
€0.00 (tax incl.)
The CDKtide peptide sequence (CKKKYSPTSPSYSPTSPSY-SPTSPS) is derived from the C-terminus of the largest subunit of human RNA polymerase II which has 52 approximate tandem repeats of 7 amino acids...
Chktide Chktide

Chktide

Reference: C10-58
€0.00 (tax incl.)
The Chktide peptide sequence (KKKVSRSGLYRSPSMPENLNRPR) is based on the human CDC25C protein isoform A (amino acid 205-225).
CK1tide CK1tide

CK1tide

Reference: C07-58-1
€0.00 (tax incl.)
The CK1tide synthetic peptide [HAAIGDDDDAYSITA-NH2] is routinely evaluated as a substrate for CK1 family kinases, such as CK1 and CK1 delta.
CREBtide CREBtide

CREBtide

Reference: C50-58
€0.00 (tax incl.)
The CREBtide peptide sequence (KRREILSRRPSYR) is based on the human CREB1 isoform A (amino acid 109-121).
Crosstide Crosstide

Crosstide

Reference: C51-58
€0.00 (tax incl.)
The Crosstide peptide sequence (GRPRTSSFAEG) is based on the GSK3.
CSKtide CSKtide

CSKtide

Reference: C63-58
€0.00 (tax incl.)
The synthetic peptide CSKtide (KKKEEIYFFFG-NH2) contains a tyrosine protein kinase phosphorylation site and can be used for CSK and TNK1 assay.
DYRKtide DYRKtide

DYRKtide

Reference: D96-58
€0.00 (tax incl.)
The synthetic peptide (RRRFRPASPLRGPPK) contains a serine/threonine protein kinase phosphorylation site and is routinely evaluated as a substrate for DYRK family kinases.
EF2tide EF2tide

EF2tide

Reference: E01-58
€0.00 (tax incl.)
The EF2tide substrate peptide sequence (RKKFGESEKTKTKEFL) is based on dictyostelium myosin II heavy chain (amino acid 2020-2035).
EIF2S Peptide EIF2S Peptide

EIF2S Peptide

Reference: E23-58
€0.00 (tax incl.)
The 13 amino acids of EIF2S peptide sequence (CILLSELSRRRIR) is derived from human protein EIF2S1 between residues 46-57. This peptide is suitable for use as a substrate for MNK1 and EIF2AK family kinases.
GRKtide GRKtide

GRKtide

Reference: G46-58
€0.00 (tax incl.)
The synthetic peptide sequence (CRRREEEEESAAA) is routinely evaluated as a substrate for GRK family kinases, including GRK2, GRK3, GRK4 and GRK7.
GS Peptide GS Peptide

GS Peptide

Reference: G60-58
€0.00 (tax incl.)
The GS peptide sequence (PLSRTLSVSS) is derived from an N-terminus of glycogen synthase and is suitable for use as the substrate for DCAMKL1 and CAMKII family.
Histone H1 Peptide Histone H1 Peptide

Histone H1 Peptide

Reference: H10-58-1
€0.00 (tax incl.)
The Histone H1 Peptide (152-159) sequence (GGGPATP-KKAKKL-COOH) is derived from human histone H1 between amino acids 152-159 and is suitable for use as the substrate for CDK family kinase assays, such as CDK1, CDK2,...
Histone H3 Peptide (1-21) Histone H3 Peptide (1-21)

Histone H3 Peptide (1-21)

Reference: H12-58-500
€0.00 (tax incl.)
The Histone H3 Peptide (1-21) sequence (ARTKQTARKS-TGGKAPRKQLAGGKKC) is derived from human histone H3 (1-21) and is suitable for use as the substrate for histone methyltransferase (at K4 and K9) and acetyltransferase...
Histone H3 Peptide (1-21) Histone H3 Peptide (1-21)

Histone H3 Peptide (1-21)

Reference: H12-58-01
€0.00 (tax incl.)
The Histone H3 Peptide (1-21) sequence (ARTKQTARKS-TGGKAPRKQLAGGKKC) is derived from human histone H3 (1-21) and is suitable for use as the substrate for histone methyltransferase (at K4 and K9) and acetyltransferase...
Histone H4 Peptide (1-21) Histone H4 Peptide (1-21)

Histone H4 Peptide (1-21)

Reference: H13-58-500
€0.00 (tax incl.)
The Histone H4 Peptide (1-21) sequence (SGRGKGGKGL-GKGGAKRHRKVGGKKC) is derived from human histone H4 (1-21) and is suitable for use as the substrate for histone methyltransferase (at R3) and acetyltransferase (at K5,...
Histone H4 Peptide (1-21) Histone H4 Peptide (1-21)

Histone H4 Peptide (1-21)

Reference: H13-58-01
€0.00 (tax incl.)
The Histone H4 Peptide (1-21) sequence (SGRGKGGKGL-GKGGAKRHRKVGGKKC) is derived from human histone H4 (1-21) and is suitable for use as the substrate for histone methyltransferase (at R3) and acetyltransferase (at K5,...
HSP27tide HSP27tide

HSP27tide

Reference: H31-58
€0.00 (tax incl.)
The HSP27tide peptide sequence (RRLNRQLSVA-amide) is based on the mouse HSP27 (amino acid 80-85).
IGF1Rtide IGF1Rtide

IGF1Rtide

Reference: I15-58
€0.00 (tax incl.)
The 14 amino acids of IGF1Rtide peptide sequence (KKKSPGEYVNIEFG) is derived from human IRS-1 protein residues 891-902.
IKKtide IKKtide

IKKtide

Reference: I33-58
€0.00 (tax incl.)
The IKKtide peptide sequence (KKKKERLLDDRHDSG-LDSMKDEE) is derived from human IkBA (amino acids 21-41) and is suitable as a substrate for IKK alpha and IKK beta.
IRS1 (Y608) Peptide IRS1 (Y608) Peptide

IRS1 (Y608) Peptide

Reference: I40-58-1000
€0.00 (tax incl.)
The synthetic IRS1 (Y608) Peptide [KKHTDDGYMPMSPGVA] is derived from mouse insulin receptor substrate 1 (amino acids 603-616) and is suitable as substrate for JAK1 and JAK2.
JAK3tide JAK3tide

JAK3tide

Reference: J03-58-1000
€0.00 (tax incl.)
The JAK3tide synthetic peptide [GGEEEEYFELVKKKK] is routinely evaluated as a substrate for JAK3 and JAK2.
LKBtide LKBtide

LKBtide

Reference: L15-58
€0.00 (tax incl.)
The synthetic peptide LKBtide (LSNLYHQGKFLQTFCGSPLY-RRRC) is derived from human NUAK2 (amino acid 196-215) and can be phosphorylated by protein Serine/Threonine kinase 11 (STK11), also known as LKB1.
LRRKtide LRRKtide

LRRKtide

Reference: L10-58
€0.00 (tax incl.)
The LRRKtide peptide sequence (RLGRDKYKTLRQIRQ) is derived from human ezrin (amino acids 561-573), moesin (amino acids 539-553) and radixin (amino acids 558-570) and is suitable for use as a substrate for LRRK kinases.
MARCKS Peptide MARCKS Peptide

MARCKS Peptide

Reference: M02-58
€0.00 (tax incl.)
The synthetic peptide (KKRFSFKKSFKL) is derived from amino acid residues 154 –165 of protein myristoylated alanine-rich C-kinase substrate (MARCKS). This peptide is suitable for use as a substrate for PKC alpha, PKC...
Micro2 Peptide Micro2 Peptide

Micro2 Peptide

Reference: M08-58-1000
€0.00 (tax incl.)
The Micro2 Peptide sequence (KEEQSQITSQVTGQIGWR) is derived from human AP-2 complex subunit mu isoform b (amino acids 143-160) and is suitable as a substrate for AAK1, BMP2K, and GAK kinase assay.
MLC Peptide MLC Peptide

MLC Peptide

Reference: M09-58
€0.00 (tax incl.)
The MLC Peptide sequence (AKRPQRATSNVFS) represents the phosphate-accepting domain of human MYL9 (amino acids 12-23) and can be used as a substrate for PHKG1, PHKG2 and DAPK2.
Modified EIF2S Peptide Modified EIF2S Peptide

Modified EIF2S Peptide

Reference: E23-58B
€0.00 (tax incl.)
The Modified EIF2S Peptide sequence (Modified-CILLSELSRRRIR) is derived from human EIF2S1 (46-57) and is suitable for use as the substrate for EIF2AK kinase family and MNK1.
Modified PLKtide Modified PLKtide

Modified PLKtide

Reference: P41-58B
€0.00 (tax incl.)
The Modified PLKtide peptide sequence (Modified-CKKLGEDQAEEISDDLLEDSLSDEDE) is derived from the CDC25C protein sequence (182-204).
Modified SGKtide Modified SGKtide

Modified SGKtide

Reference: S08-58B
€0.00 (tax incl.)
The Modified SGKtide peptide sequence (Modified- CKKRNRRLSVA) contains serine protein kinase phosphorylation site and is evaluated as a substrate for SGK and NDR family kinases.
MRCL3 Peptide MRCL3 Peptide

MRCL3 Peptide

Reference: M56-58
€0.00 (tax incl.)
The synthetic substrate MRCL3 Peptide (KKRPQRATSN-VFAM-NH2) is derived from human myosin regulatory light chain MRCL3 (amino acid 11-24) and can be used for MLCK, MYLK2 and MYLK3 kinase assay.
PAKtide PAKtide

PAKtide

Reference: P08-58
€0.00 (tax incl.)
The 10 amino acids of PAKtide peptide (RRRLSFAEPG) contain a serine/threonine protein kinase phosphorylation site in a common seven-residue epitope (1, 2).
PDHKtide PDHKtide

PDHKtide

Reference: P57-58
€0.00 (tax incl.)
The synthetic peptide substrate PDHKtide (RRYHGHSMS-DPGVSYRTR) is derived from human PDHA1 protein (amino acid 288-304aa) and can be used for PDHK family kinase assay.
PDKtide PDKtide

PDKtide

Reference: P10-58
€0.00 (tax incl.)
The 39 amino acids of PDKtide peptide sequence ([protein fragment, 39 aa]) is derived from two human proteins: residues 1-14 are based on AKT1 (307-320) and residues 16-39 are based on PKN2/PRK2 (961-984).
PKCtide PKCtide

PKCtide

Reference: P15-58
€0.00 (tax incl.)
The PKCtide peptide sequence (ERMRPRKRQGSVRRRV) is based on protein kinase C epsilon (amino acid 149-164).
PLKtide PLKtide

PLKtide

Reference: P41-58
€0.00 (tax incl.)
The PLKtide peptide sequence (CKKLGEDQAEEISDDLLED-SLSDEDE) is derived from the CDC25C protein sequence (182-204).
Poly (4:1 Glu, Tyr) Peptide Poly (4:1 Glu, Tyr) Peptide

Poly (4:1 Glu, Tyr) Peptide

Reference: P61-58
€0.00 (tax incl.)
The Poly (4:1 Glu, Tyr) substrate peptide is used as universal substrate for protein tyrosine kinases.
PS7-CTD Peptide PS7-CTD Peptide

PS7-CTD Peptide

Reference: R06-58-
€0.00 (tax incl.)
The PS7-CTD peptide sequence (YSPTS PpSYSP TSPpS) is derived from C-terminal repeat domain of human RNA polymerase II.
RS Repeat Peptide RS Repeat Peptide

RS Repeat Peptide

Reference: R55-58
€0.00 (tax incl.)
The synthetic peptide (GRSRSRSRSRSRSRSR) contains serine/threonine protein kinase phosphorylation sites and is routinely evaluated as a substrate for CLK, EIF2AK and SRPK family kinases.
SAMStide SAMStide

SAMStide

Reference: S07-58
€0.00 (tax incl.)
The SAMStide peptide sequence (HMRSAMSGLHLVKRR) is based on the mouse acetyl-Coenzyme A carboxylase alpha (amino acid 73-85).
SGKtide SGKtide

SGKtide

Reference: S08-58
€0.00 (tax incl.)
The SGKtide peptide sequence (CKKRNRRLSVA) contains serine protein kinase phosphorylation site and is evaluated as a substrate for SGK and NDR family kinases.
TGFBR1 Peptide TGFBR1 Peptide

TGFBR1 Peptide

Reference: T36-58
€0.00 (tax incl.)
The TGFBR1 peptide sequence (KKKVLTQMGSPSIRC-S(pS)VS) is derived from human SMAD3 (215-230) and is suitable for use as the substrate for TGFBR1 superfamily, including ACVRs (ALK1, ALK2, ALK4 and ALK7) and BMPRs (ALK3...
Thr-phosphopeptide Thr-phosphopeptide

Thr-phosphopeptide

Reference: T69-58
€0.00 (tax incl.)
The Thr-phosphopeptide sequence (KRT(p)IRR) is derived from human NR2F6 (amino acids 79-84) and is suitable as a substrate for PP2A, PP2B, PP2C and PP1.
Thr-phosphopeptide-3 Thr-phosphopeptide-3

Thr-phosphopeptide-3

Reference: T72-58-01
€0.00 (tax incl.)
The Thr-phosphopeptide-3 sequence (RRAT(p)VA) is a phosphorylated threonyl derivative from human pyruvate kinase (amino acids 40-45) and is suitable as a substrate for PP1, PP2A, and PP2C (e.g. WIP1).
Tyr-phosphopeptide-2 Tyr-phosphopeptide-2

Tyr-phosphopeptide-2

Reference: T70-58
€0.00 (tax incl.)
The Tyr-phosphopeptide-2 sub peptide sequence (DADEY(p)LIPDQG) is based on mouse epidermal growth factor receptor isoform 1 (amino acid 1014-1024).
ULKtide ULKtide

ULKtide

Reference: U01-58-1
€0.00 (tax incl.)
The ULKtide synthetic peptide [YANWLAASIYLDGKKK] is routinely evaluated as a substrate for ULK family kinase assays.
ZIPtide ZIPtide

ZIPtide

Reference: Z16-58
€0.00 (tax incl.)
The ZIPtide substrate peptide sequence (KKLNRTLSFAEPG) is routinely evaluated as a substrate for DAPK3 (ZIPK).
Asc Antibody (AL177) Blocking Peptide Asc Antibody (AL177) Blocking Peptide

Asc Antibody (AL177) Blocking Peptide

Reference: AG-37B-0001-C100
€0.00 (tax incl.)
Blocking Peptide for anti-Asc, pAb (AL177) https://adipogen.com/catalogsearch/result/?q=al177 . This vial contains 100µg peptide in 100µl sterile water. The Asc Antibody (AL177) Blocking Peptide can be used in...
Human IL1 beta recombinant protein (Active) (His-tagged, C-ter) Human IL1 beta recombinant protein (Active) (His-tagged, C-ter)

Human IL1 beta recombinant protein (Active) (His-tagged, C-ter)

Reference: ARG70028
€0.00 (tax incl.)
IL1 beta protein is a member of the interleukin 1 cytokine family. This cytokine is produced by activated macrophages as a proprotein, which is proteolytically processed to its active form by caspase 1 (CASP1/ICE)....
Human IL2 recombinant protein (Active) (His-tagged, C-ter) Human IL2 recombinant protein (Active) (His-tagged, C-ter)

Human IL2 recombinant protein (Active) (His-tagged, C-ter)

Reference: ARG70029
€0.00 (tax incl.)
The protein encoded by this gene is a secreted cytokine that is important for the proliferation of T and B lymphocytes. The receptor of this cytokine is a heterotrimeric protein complex whose gamma chain is also...
Human IL6 recombinant protein (Active) (His-tagged, C-ter) Human IL6 recombinant protein (Active) (His-tagged, C-ter)

Human IL6 recombinant protein (Active) (His-tagged, C-ter)

Reference: ARG70030
€0.00 (tax incl.)
This gene encodes a cytokine that functions in inflammation and the maturation of B cells. In addition, the encoded protein has been shown to be an endogenous pyrogen capable of inducing fever in people with...
Human IL8 recombinant protein (Active) (His-tagged, C-ter) Human IL8 recombinant protein (Active) (His-tagged, C-ter)

Human IL8 recombinant protein (Active) (His-tagged, C-ter)

Reference: ARG70031
€0.00 (tax incl.)
The protein encoded by this gene is a member of the CXC chemokine family. This chemokine is one of the major mediators of the inflammatory response. This chemokine is secreted by several cell types. It functions as a...
Human IL10 recombinant protein (Active) (His-tagged, C-ter) Human IL10 recombinant protein (Active) (His-tagged, C-ter)

Human IL10 recombinant protein (Active) (His-tagged, C-ter)

Reference: ARG70032
€0.00 (tax incl.)
The protein encoded by this gene is a cytokine produced primarily by monocytes and to a lesser extent by lymphocytes. This cytokine has pleiotropic effects in immunoregulation and inflammation. It down-regulates the...
Human TNF alpha recombinant protein (Active) (His-tagged, C-ter) Human TNF alpha recombinant protein (Active) (His-tagged, C-ter)

Human TNF alpha recombinant protein (Active) (His-tagged, C-ter)

Reference: ARG70034
€0.00 (tax incl.)
This gene encodes a multifunctional proinflammatory cytokine that belongs to the tumor necrosis factor (TNF) superfamily. This cytokine is mainly secreted by macrophages. It can bind to, and thus functions through its...
Human GM-CSF recombinant protein (Active) (His-tagged, N-ter) Human GM-CSF recombinant protein (Active) (His-tagged, N-ter)

Human GM-CSF recombinant protein (Active) (His-tagged, N-ter)

Reference: ARG70037
€0.00 (tax incl.)
The protein encoded by this gene is a cytokine that controls the production, differentiation, and function of granulocytes and macrophages. The active form of the protein is found extracellularly as a homodimer. This...
Mouse TNF alpha recombinant protein (Active) (His-tagged, C-ter) Mouse TNF alpha recombinant protein (Active) (His-tagged, C-ter)

Mouse TNF alpha recombinant protein (Active) (His-tagged, C-ter)

Reference: ARG70041
€0.00 (tax incl.)
This gene encodes a multifunctional proinflammatory cytokine that belongs to the tumor necrosis factor (TNF) superfamily. This cytokine is mainly secreted by macrophages. It can bind to, and thus functions through its...
Human IL1 alpha recombinant protein (Active) (His-tagged, C-ter) Human IL1 alpha recombinant protein (Active) (His-tagged, C-ter)

Human IL1 alpha recombinant protein (Active) (His-tagged, C-ter)

Reference: ARG70042
€0.00 (tax incl.)
The protein encoded by this gene is a member of the interleukin 1 cytokine family. This cytokine is a pleiotropic cytokine involved in various immune responses, inflammatory processes, and hematopoiesis. This cytokine...
Human IL1RA recombinant protein (Active) (His-tagged, C-ter) Human IL1RA recombinant protein (Active) (His-tagged, C-ter)

Human IL1RA recombinant protein (Active) (His-tagged, C-ter)

Reference: ARG70044
€0.00 (tax incl.)
The protein encoded by this gene is a member of the interleukin 1 cytokine family. This protein inhibits the activities of interleukin 1, alpha (IL1A) and interleukin 1, beta (IL1B), and modulates a variety of...
Human IL3 recombinant protein (Active) (His-tagged, C-ter) Human IL3 recombinant protein (Active) (His-tagged, C-ter)

Human IL3 recombinant protein (Active) (His-tagged, C-ter)

Reference: ARG70046
€0.00 (tax incl.)
The protein encoded by this gene is a potent growth promoting cytokine. This cytokine is capable of supporting the proliferation of a broad range of hematopoietic cell types. It is involved in a variety of cell...
Human IL4 recombinant protein (Active) (His-tagged, C-ter) Human IL4 recombinant protein (Active) (His-tagged, C-ter)

Human IL4 recombinant protein (Active) (His-tagged, C-ter)

Reference: ARG70047
€0.00 (tax incl.)
The protein encoded by this gene is a pleiotropic cytokine produced by activated T cells. This cytokine is a ligand for interleukin 4 receptor. The interleukin 4 receptor also binds to IL13, which may contribute to...
Human IL5 recombinant protein (Active) (His-tagged, C-ter) Human IL5 recombinant protein (Active) (His-tagged, C-ter)

Human IL5 recombinant protein (Active) (His-tagged, C-ter)

Reference: ARG70048
€0.00 (tax incl.)
This gene encodes a cytokine that acts as a growth and differentiation factor for both B cells and eosinophils. The encoded cytokine plays a major role in the regulation of eosinophil formation, maturation,...
Human IL7 recombinant protein (Active) (His-tagged, C-ter) Human IL7 recombinant protein (Active) (His-tagged, C-ter)

Human IL7 recombinant protein (Active) (His-tagged, C-ter)

Reference: ARG70050
€0.00 (tax incl.)
The protein encoded by this gene is a cytokine important for B and T cell development. This cytokine and the hepatocyte growth factor (HGF) form a heterodimer that functions as a pre-pro-B cell growth-stimulating...
Human IL9 recombinant protein (Active) (His-tagged, N-ter) Human IL9 recombinant protein (Active) (His-tagged, N-ter)

Human IL9 recombinant protein (Active) (His-tagged, N-ter)

Reference: ARG70052
€0.00 (tax incl.)
The protein encoded by this gene is a cytokine that acts as a regulator of a variety of hematopoietic cells. This cytokine stimulates cell proliferation and prevents apoptosis. It functions through the interleukin 9...
Human IL11 recombinant protein (Active) (His-tagged, N-ter) Human IL11 recombinant protein (Active) (His-tagged, N-ter)

Human IL11 recombinant protein (Active) (His-tagged, N-ter)

Reference: ARG70054
€0.00 (tax incl.)
The protein encoded by this gene is a member of the gp130 family of cytokines. These cytokines drive the assembly of multisubunit receptor complexes, all of which contain at least one molecule of the transmembrane...
Human IL13 recombinant protein (Active) (His-tagged, C-ter) Human IL13 recombinant protein (Active) (His-tagged, C-ter)

Human IL13 recombinant protein (Active) (His-tagged, C-ter)

Reference: ARG70057
€0.00 (tax incl.)
This gene encodes an immunoregulatory cytokine produced primarily by activated Th2 cells. This cytokine is involved in several stages of B-cell maturation and differentiation. It up-regulates CD23 and MHC class II...
Human IL15 recombinant protein (Active) (His-tagged, N-ter) Human IL15 recombinant protein (Active) (His-tagged, N-ter)

Human IL15 recombinant protein (Active) (His-tagged, N-ter)

Reference: ARG70058
€0.00 (tax incl.)
The protein encoded by this gene is a cytokine that regulates T and natural killer cell activation and proliferation. This cytokine and interleukine 2 share many biological activities. They are found to bind common...
Human IL17B recombinant protein (Active) (His-tagged, C-ter) Human IL17B recombinant protein (Active) (His-tagged, C-ter)

Human IL17B recombinant protein (Active) (His-tagged, C-ter)

Reference: ARG70060
€0.00 (tax incl.)
The protein encoded by this gene is a T cell-derived cytokine that shares sequence similarity with IL17. This cytokine was reported to stimulate the release of TNF alpha (TNF) and IL1 beta (IL1B) from a monocytic cell...
Human IL17F recombinant protein (Active) (His-tagged, C-ter) Human IL17F recombinant protein (Active) (His-tagged, C-ter)

Human IL17F recombinant protein (Active) (His-tagged, C-ter)

Reference: ARG70061
€0.00 (tax incl.)
The protein encoded by this gene is a cytokine that shares sequence similarity with IL17. This cytokine is expressed by activated T cells, and has been shown to stimulate the production of several other cytokines,...
Human IL18 recombinant protein (Active) (His-tagged, C-ter) Human IL18 recombinant protein (Active) (His-tagged, C-ter)

Human IL18 recombinant protein (Active) (His-tagged, C-ter)

Reference: ARG70062
€0.00 (tax incl.)
The protein encoded by this gene is a proinflammatory cytokine that augments natural killer cell activity in spleen cells, and stimulates interferon gamma production in T-helper type I cells. Alternatively spliced...
Human IL19 recombinant protein (Active) (His-tagged, C-ter) Human IL19 recombinant protein (Active) (His-tagged, C-ter)

Human IL19 recombinant protein (Active) (His-tagged, C-ter)

Reference: ARG70063
€0.00 (tax incl.)
The protein encoded by this gene is a cytokine that belongs to the IL10 cytokine subfamily. This cytokine is found to be preferentially expressed in monocytes. It can bind the IL20 receptor complex and lead to the...
Human IL20 recombinant protein (Active) (His-tagged, C-ter) Human IL20 recombinant protein (Active) (His-tagged, C-ter)

Human IL20 recombinant protein (Active) (His-tagged, C-ter)

Reference: ARG70064
€0.00 (tax incl.)
The protein encoded by this gene is a cytokine structurally related to interleukin 10 (IL10). This cytokine has been shown to transduce its signal through signal transducer and activator of transcription 3 (STAT3) in...
Human IL21 recombinant protein (Active) (His-tagged, C-ter) Human IL21 recombinant protein (Active) (His-tagged, C-ter)

Human IL21 recombinant protein (Active) (His-tagged, C-ter)

Reference: ARG70065
€0.00 (tax incl.)
This gene encodes a member of the common-gamma chain family of cytokines with immunoregulatory activity. The encoded protein plays a role in both the innate and adaptive immune responses by inducing the...
Human IL24 recombinant protein (Active) (His-tagged, C-ter) Human IL24 recombinant protein (Active) (His-tagged, C-ter)

Human IL24 recombinant protein (Active) (His-tagged, C-ter)

Reference: ARG70068
€0.00 (tax incl.)
This gene encodes a member of the IL10 family of cytokines. It was identified as a gene induced during terminal differentiation in melanoma cells. The protein encoded by this gene can induce apoptosis selectively in...
Human IL26 recombinant protein (Active) (His-tagged, C-ter) Human IL26 recombinant protein (Active) (His-tagged, C-ter)

Human IL26 recombinant protein (Active) (His-tagged, C-ter)

Reference: ARG70070
€0.00 (tax incl.)
This gene was identified by its overexpression specifically in herpesvirus samimiri-transformed T cells. The encoded protein is a member of the IL10 family of cytokines. It is a secreted protein and may function as a...
Human IL28B recombinant protein (Active) (His-tagged, C-ter) Human IL28B recombinant protein (Active) (His-tagged, C-ter)

Human IL28B recombinant protein (Active) (His-tagged, C-ter)

Reference: ARG70073
€0.00 (tax incl.)
This gene encodes a cytokine distantly related to type I interferons and the IL-10 family. This gene, interleukin 28A (IL28A), and interleukin 29 (IL29) are three closely related cytokine genes that form a cytokine...
Human IL31 recombinant protein (Active) (His-tagged, C-ter) Human IL31 recombinant protein (Active) (His-tagged, C-ter)

Human IL31 recombinant protein (Active) (His-tagged, C-ter)

Reference: ARG70075
€0.00 (tax incl.)
IL31, which is made principally by activated Th2-type T cells, interacts with a heterodimeric receptor consisting of IL31RA (MIM 609510) and OSMR (MIM 601743) that is constitutively expressed on epithelial cells and...

Menu

Settings

Please sign in first.

Sign in