Z-D-Phg-OH Reference: HY-75332 Z-D-Phg-OH (D-Cbz phenylglycine) is a N-blocked amino acids with Kd values of 390 μM and 323 μM for tBuCQN and tBuCQD, respectively.
Human PLA2G2A protein, His tag Reference: GTX01242-pro-S The protein encoded by this gene is a member of the phospholipase A2 family (PLA2). PLA2s constitute a diverse family of enzymes with respect to sequence, function, localization, and divalent cation requirements. This gene product belongs to group II, which contains secreted form of PLA2, an extracellular enzyme that has a low molecular mass and requires calcium ions for catalysis. It catalyzes the hydrolysis of the sn-2 fatty acid acyl ester bond of phosphoglycerides, releasing free fatty acids and lysophospholipids, and thought to participate in the regulation of the phospholipid metabolism in biomembranes. Several alternatively spliced transcript variants with different 5 UTRs have been found for this gene.[provided by RefSeq, Sep 29]
GIP (3-42), human Reference: HY-P2542 GIP (3-42), human acts as a glucose-dependent insulinotropic polypeptide (GIP) receptor antagonist, moderating the insulin secreting and metabolic actions of GIP in vivo.
Human PLA2G2A protein, His tag Reference: GTX01242-pro The protein encoded by this gene is a member of the phospholipase A2 family (PLA2). PLA2s constitute a diverse family of enzymes with respect to sequence, function, localization, and divalent cation requirements. This gene product belongs to group II, which contains secreted form of PLA2, an extracellular enzyme that has a low molecular mass and requires calcium ions for catalysis. It catalyzes the hydrolysis of the sn-2 fatty acid acyl ester bond of phosphoglycerides, releasing free fatty acids and lysophospholipids, and thought to participate in the regulation of the phospholipid metabolism in biomembranes. Several alternatively spliced transcript variants with different 5 UTRs have been found for this gene.[provided by RefSeq, Sep 29]
Substance P(1-4) Reference: HY-P3598 Substance P(1-4) is a potent neurokinin receptors (NK-R) antagonist. Substance P(1-4) has regulation of normal hematopoiesis and inhibits endogenous erythroid colony (EEC) formation.
Human PPAR gamma protein, GST and His tag Reference: GTX01243-pro-S This gene encodes a member of the peroxisome proliferator-activated receptor (PPAR) subfamily of nuclear receptors. PPARs form heterodimers with retinoid X receptors (RXRs) and these heterodimers regulate transcription of various genes. Three subtypes of PPARs are known: PPAR-alpha, PPAR-delta, and PPAR-gamma. The protein encoded by this gene is PPAR-gamma and is a regulator of adipocyte differentiation. Additionally, PPAR-gamma has been implicated in the pathology of numerous diseases including obesity, diabetes, atherosclerosis and cancer. Alternatively spliced transcript variants that encode different isoforms have been described. [provided by RefSeq, Jul 28]
NMNNAGDKWSAFLKEQSTLAQMYPLQEIQNLTVKLQLQALQQ Reference: HY-P3142 NMNNAGDKWSAFLKEQSTLAQMYPLQEIQNLTVKLQLQALQQ is an angiotensin-converting enzyme 2 (ACE2) related peptide that can be used as a tool for understanding ACE2 functions.
Human PPAR gamma protein, GST and His tag Reference: GTX01243-pro This gene encodes a member of the peroxisome proliferator-activated receptor (PPAR) subfamily of nuclear receptors. PPARs form heterodimers with retinoid X receptors (RXRs) and these heterodimers regulate transcription of various genes. Three subtypes of PPARs are known: PPAR-alpha, PPAR-delta, and PPAR-gamma. The protein encoded by this gene is PPAR-gamma and is a regulator of adipocyte differentiation. Additionally, PPAR-gamma has been implicated in the pathology of numerous diseases including obesity, diabetes, atherosclerosis and cancer. Alternatively spliced transcript variants that encode different isoforms have been described. [provided by RefSeq, Jul 28]
Fequesetide Reference: HY-P2463 Fequesetide, a peptide segment, is the active site within the protein thymosin β4 responsible for actin binding, cell migration and wound healing.
Human Protein C protein, His tag Reference: GTX01244-pro-S This gene encodes a vitamin K-dependent plasma glycoprotein. The encoded protein is cleaved to its activated form by the thrombin-thrombomodulin complex. This activated form contains a serine protease domain and functions in degradation of the activated forms of coagulation factors V and VIII. Mutations in this gene have been associated with thrombophilia due to protein C deficiency, neonatal purpura fulminans, and recurrent venous thrombosis.[provided by RefSeq, Dec 29]
Adipokinetic hormone (Gryllus bimaculatus) Reference: HY-P3568 Adipokinetic hormone Gryllus bimaculatus (Grybi-AKH) is an adipokinetic hormone that regulates energy homeostasis in insects by mobilizing lipid and carbohydrate from the fat body. Adipokinetic hormone Gryllus bimaculatus stimulates the locomotor activity of the two-spotted cricket. Adipokinetic hormone Gryllus bimaculatus can also be used in studies to regulate body weight, induce weight loss and alleviate glycogen storage disorders in humans.
Human Protein C protein, His tag Reference: GTX01244-pro This gene encodes a vitamin K-dependent plasma glycoprotein. The encoded protein is cleaved to its activated form by the thrombin-thrombomodulin complex. This activated form contains a serine protease domain and functions in degradation of the activated forms of coagulation factors V and VIII. Mutations in this gene have been associated with thrombophilia due to protein C deficiency, neonatal purpura fulminans, and recurrent venous thrombosis.[provided by RefSeq, Dec 29]