Proteins & Peptides (185)

Recombinant Mouse SCF

Reference: P4897

€0.00 (tax incl.)

Synonyms: C kit ligand, C-kit ligand, Ckit ligand, DCUA, DFNA69, DKFZp686F2250, familial progressive hyperpigmentation 2, FPH2, FPHH, KIT ligand, Kitl, KITLG, KL 1, KL1, Mast cell growth factor, MGF, MGF stem cell...

SV40 T-Ag-derived NLS peptide

Reference: HY-P1877

€0.00 (tax incl.)

SV40 T-Ag-derived NLS peptide is a nuclear localization signal DNA tagged to this peptide efficiently translocates into the cell nucleus.

Recombinant Human IMPDH1

Reference: P4898

€0.00 (tax incl.)

Synonyms: IMDH1_HUMAN, IMP (inosine monophosphate) dehydrogenase 1, IMP dehydrogenase 1, IMPD, IMPD 1, IMPD1, IMPDH 1, IMPDH I, IMPDH-I, Impdh1, Inosine 5' monophosphate dehydrogenase 1, Inosine monophosphate...

VSGLNPSLWSIFGLQFILLWLVSGSRHYLW TFA

Reference: HY-P3431A

€0.00 (tax incl.)

VSGLNPSLWSIFGLQFILLWLVSGSRHYLW (TFA) is a 30-amino-acid peptide mimicking the C-terminal domain of α2δ-1, termed as α2δ-1Tat peptide. VSGLNPSLWSIFGLQFILLWLVSGSRHYLW can effectively interrupt the α2δ-1 - NMDAR...

Recombinant Human C4 binding

Reference: P4899

€0.00 (tax incl.)

Synonyms: C4b binding protein beta chain, C4b-binding protein beta chain, C4BP, C4BPB, C4BPB_HUMAN, Complement component 4 binding protein beta, Complement component 4 binding protein beta chain, Complement component...

G2-Peptide

Reference: HY-P3795

€0.00 (tax incl.)

G2-Peptide is an peptide. G2-Peptide can be used for the research of various biochemical.

Recombinant Rat PAI1

Reference: P4900

€0.00 (tax incl.)

Synonyms: Clade E, Endothelial plasminogen activator inhibitor, Nexin, Nexin plasminogen activator inhibitor type 1, PAI, PAI 1, PAI-1, PAI1_HUMAN, PLANH1, Plasminogen activator inhibitor 1, Plasminogen activator...

GR 87389

Reference: HY-P3853

€0.00 (tax incl.)

GR 87389 is a potent NK2 receptor antagonist. GR 87389 antagonized GA 64349-induced smooth muscle strips contractions in a competitive manner in the human detrusor, prostate and prostatic urethra.

Recombinant Human PTMS

Reference: P4901

€0.00 (tax incl.)

Synonyms: ParaT, Parathymosin, Ptms, PTMS_HUMAN. Lyophilized from a 0.2um filtered solution in PBS with 5% trehalose, pH7.4

H3K27(Me3) (15-34)

Reference: HY-P2254

€0.00 (tax incl.)

H3K27(Me3) (15-34), a histone peptide, is a repressive chromatin mark derived from human histone. Polycomb Repressive Complex 2 (PRC2) is a multiprotein complex that catalyzes the methylation of H3K27(Me).

Recombinant Human CD3 zeta

Reference: P4902

€0.00 (tax incl.)

Synonyms: 4930549J05Rik, A430104F18Rik, AW552088, CD247, CD247 antigen, Cd247 molecule, Cd3, CD3 antigen, zeta polypeptide, isoform CRA_b, CD3 antigen, zeta subunit, CD3-eta, CD3H, CD3Q, Cd3z, CD3Z antigen zeta...

H-Leu-OtBu.HCl

Reference: HY-W008061

€0.00 (tax incl.)

H-Leu-OtBu.HCl is a leucine derivative.

Recombinant Human PTN

Reference: P4903

€0.00 (tax incl.)

Synonyms: HARP, HB-GAM, HBBM, HBGAM, HBGF-8, HBGF8, HBNF, HBNF-1, HBNF1, heparin affin regulatory protein, Heparin binding growth associated molecule, Heparin binding growth factor 8, Heparin binding neurite outgrowth...

[Leu5]-Enkephalin

Reference: HY-P0288

€0.00 (tax incl.)

[Leu5]-Enkephalin is a pentapeptide with morphine like properties. [Leu5]-Enkephalin is a five amino acid endogenous peptide that acts as an agonist at opioid receptors.

Recombinant Human GSTM3

Reference: P4904

€0.00 (tax incl.)

Synonyms: brain GST, brain type mu glutathione S transferase, glutathione S alkyltransferase M3, glutathione S aryltransferase M3, glutathione S transferase M3, glutathione S transferase M3 (brain), Glutathione S...

SPR741

Reference: HY-P1649

€0.00 (tax incl.)

SPR741 (NAB741) is a cationic peptide derived from polymyxin B and is a potentiator molecule. SPR741 increases the permeability of the outer membrane of Gram-negative bacteria and is used to treat severe Gram-negative...

Recombinant Mouse BMP4

Reference: P4905

€0.00 (tax incl.)

Synonyms: zgc:100779, BMP 2B, BMP 4, BMP-2B, BMP-4, BMP2B, BMP2B1, BMP4, BMP4_HUMAN, Bone morphogenetic protein 2B, Bone morphogenetic protein 4, DVR4, MCOPS6, MGC100779, OFC11, zbmp-4, ZYME. Lyophilized from a 0.2um...

Dibenzyl L-glutamate tosylate

Reference: HY-W010785

€0.00 (tax incl.)

Dibenzyl L-glutamate tosylate is a glutamic acid derivative.

Recombinant Human ZNF10

Reference: P4906

€0.00 (tax incl.)

Synonyms: KOX1, Zinc finger protein 10, Zinc finger protein 10 (KOX 1), Zinc finger protein KOX1, ZNF10, ZNF10_HUMAN. Lyophilized from a 0.2um filtered solution in PBS with 5% trehalose, pH7.4

Cdk2/Cyclin Inhibitory Peptide II

Reference: HY-P3731

€0.00 (tax incl.)

Cdk2/Cyclin Inhibitory Peptide II (Tat-LDL), a CDK2 inhibitor, kills U2OS osteosarcoma cells in a dose-dependent manner.

Recombinant Human SYT1

Reference: P4907

€0.00 (tax incl.)

Synonyms: DKFZp781D2042, FLJ42519, p65, SVP65, Synaptotagmin 2, Synaptotagmin I, Synaptotagmin II, Synaptotagmin-1, SYT, Syt1, SYT1_HUMAN, Syt2, SytI. Lyophilized from a 0.2um filtered solution in PBS with 5%...

ACTH (3-24) (human, bovine, mouse, ovine, porcine, rabbit, rat)

Reference: HY-P3977

€0.00 (tax incl.)

ACTH (3-24) (human, bovine, mouse, ovine, porcine, rabbit, rat) is the 3-24 fragment of adrenocorticotropic hormone (ACTH). ACTH (3-24) (human, bovine, mouse, ovine, porcine, rabbit, rat) can be used for research of a...

Recombinant Human TNFAIP3

Reference: P4908

€0.00 (tax incl.)

Synonyms: A20, AISBL, MGC104522, MGC138687, MGC138688, OTU domain containing protein 7C, OTU domain-containing protein 7C, OTUD7C, Putative DNA binding protein A20, Putative DNA-binding protein A20, TNAP3_HUMAN, TNF...

(S)-Ethyl 2-amino-4-fluoro-4-methylpentanoate sulfate

Reference: HY-77026

€0.00 (tax incl.)

(S)-Ethyl 2-amino-4-fluoro-4-methylpentanoate sulfate is a leucine derivative.

Recombinant Rat SCF

Reference: P4909

€0.00 (tax incl.)

Synonyms: C kit ligand, C-kit ligand, Ckit ligand, DCUA, DFNA69, DKFZp686F2250, familial progressive hyperpigmentation 2, FPH2, FPHH, KIT ligand, Kitl, KITLG, KL 1, KL1, Mast cell growth factor, MGF, MGF stem cell...

S-(5′-Adenosyl)-L-cysteine

Reference: HY-111592

€0.00 (tax incl.)

S-(5′-Adenosyl)-L-cysteine is a cysteine derivative.

Recombinant Human SCF

Reference: P4910

€0.00 (tax incl.)

Synonyms: C kit ligand, C-kit ligand, Ckit ligand, DCUA, DFNA69, DKFZp686F2250, familial progressive hyperpigmentation 2, FPH2, FPHH, KIT ligand, Kitl, KITLG, KL 1, KL1, Mast cell growth factor, MGF, MGF stem cell...

Insulin degludec

Reference: HY-108743

€0.00 (tax incl.)

Insulin degludec is an ultra-long-acting form of insulin used for the research of hyperglycemia caused by type 1 and type 2 dabetes. Insulin degludec shows binding efficiency with an IC50 value of 19.59 nM for insulin...

Recombinant Mouse Vitamin D Binding

Reference: P4911

€0.00 (tax incl.)

Synonyms: DBP, DBP/GC, GC, Gc globulin, Gc-globulin, GRD3, Group specific component, Group specific component vitamin D binding protein, Group-specific component, hDBP, VDB, VDBG, VDBP, Vitamin D binding alpha...

Z-VRPR-FMK TFA

Reference: HY-P1407

€0.00 (tax incl.)

Z-VRPR-FMK (TFA) (VRPR), a tetrapeptide, is a selective and irreversible MALT1 (Mucosa-associated lymphoid tissue lymphoma translocation protein 1) inhibitor. Z-VRPR-FMK (TFA) can protect against influenza A virus...

Recombinant Human TAF1

Reference: P4912

€0.00 (tax incl.)

Synonyms: BA2R, CCG 1, CCG1, CCGS, Cell cycle G1 phase defect, Cell cycle gene 1 protein, Complementation of cell cycle block G1 to S, DYT3 protein, NSCL 2, NSCL2, OF, p250, TAF 1, TAF(II)250, TAF1 RNA polymerase II,...

Fmoc-alpha-allyl-L-alanine

Reference: HY-W007052

€0.00 (tax incl.)

Fmoc-alpha-allyl-L-alanine is an Fmoc-protected alanine derivative.

Recombinant Human TAF1

Reference: P4913

€0.00 (tax incl.)

Synonyms: BA2R, CCG 1, CCG1, CCGS, Cell cycle G1 phase defect, Cell cycle gene 1 protein, Complementation of cell cycle block G1 to S, DYT3 protein, NSCL 2, NSCL2, OF, p250, TAF 1, TAF(II)250, TAF1 RNA polymerase II,...

HPV16-E711-20 epitope

Reference: HY-P1881

€0.00 (tax incl.)

HPV16-E711-20 epitope is a well-known HLA-A*0201-restricted human cytotoxic T lymphocyte (CTL) epitope of the HPV16 E7 protein that shows high-affinity binding to HLA-A2 in vitro. HPV16 CTL epitopes may be good...

Recombinant Human TAF1

Reference: P4914

€0.00 (tax incl.)

Synonyms: BA2R, CCG 1, CCG1, CCGS, Cell cycle G1 phase defect, Cell cycle gene 1 protein, Complementation of cell cycle block G1 to S, DYT3 protein, NSCL 2, NSCL2, OF, p250, TAF 1, TAF(II)250, TAF1 RNA polymerase II,...

2-Amino-3,3,3-trifluoropropanoic acid

Reference: HY-W017551

€0.00 (tax incl.)

2-Amino-3,3,3-trifluoropropanoic acid is an alanine derivative.

Recombinant Human Glycerol 3 Phosphate Dehydrogenase

Reference: P4915

€0.00 (tax incl.)

Synonyms: AI747587, cytoplasmic, EC 1.1.1.8, FLJ26652, G3PD, Gdc-1, Gdc1, Gdp1, Glycerol 3 phosphate dehydrogenase 1, Glycerol 3 phosphate dehydrogenase cytosolic, Glycerol 3 phosphate dehydrogenase soluble,...

Polymyxin B nonapeptide

Reference: HY-106783

€0.00 (tax incl.)

Polymyxin B nonapeptide is a cyclic peptide obtained from Polymyxin B by proteolytic removal of its terminal amino acyl residue. Polymyxin B nonapeptide is less toxic, lacks bactericidal activity, and retains its...

Recombinant Rat IGFBP1

Reference: P4916

€0.00 (tax incl.)

Synonyms: AFBP, Alpha pregnancy associated endometrial globulin, Amniotic fluid binding protein, Binding protein 25, Binding protein 26, Binding protein 28, Growth hormone independent binding protein, hIGFBP 1,...

(S)-1-(tert-Butoxycarbonyl)-2-methylpyrrolidine-2-carboxylic acid

Reference: HY-W051093

€0.00 (tax incl.)

(S)-1-(tert-Butoxycarbonyl)-2-methylpyrrolidine-2-carboxylic acid is a proline derivative.

Recombinant Human KGF

Reference: P4917

€0.00 (tax incl.)

Synonyms: FGF 7, FGF-7, Fgf7, FGF7_HUMAN, Fibroblast growth factor 7, HBGF 7, HBGF-7, HBGF7, Heparin binding growth factor 7, Heparin-binding growth factor 7, Keratinocyte growth factor, KGF. Lyophilized from a 0.2um...

Angiotensin I/II (1-6) (TFA)

Reference: HY-P1829A

€0.00 (tax incl.)

Angiotensin I/II (1-6) TFA contains the amino acids 1-6 and is converted from Angiotensin I/II peptide. The precursor angiotensinogen is cleaved by renin to form angiotensin I. Angiotensin I ishydrolyzed by...

Recombinant Mouse TPSB2

Reference: P4918

€0.00 (tax incl.)

Synonyms: Mast cell tryptase beta II, Mast cell tryptase beta III, TPS2, TPSB2, TRYB2_HUMAN, Tryptase beta 2 (gene/pseudogene), Tryptase beta-2, Tryptase II, Tryptase-2, TryptaseB, TryptaseC. Lyophilized from a 0.2um...

cyclo(Phe-Ala-Gly-Arg-Arg-Arg-Gly-AEEAc)

Reference: HY-139741

€0.00 (tax incl.)

cyclo(Phe-Ala-Gly-Arg-Arg-Arg-Gly-AEEAc) provides an avenue for developing a nonhormonal male contraceptive by blocking of GRTH/DDX25 phosphorylation.

Recombinant Human CD9

Reference: P4919

€0.00 (tax incl.)

Synonyms: Tetraspanin 29, 5H9, 5H9 antigen, Antigen defined by monoclonal antibody 602 29, Antigen defined by monoclonal antibody 60229, BA-2/p24 antigen, BA2, BTCC 1, BTCC1, CD9, CD9 antigen, CD9 antigen p24, CD9...

H-D-Ala-OtBu.HCl

Reference: HY-W016426

€0.00 (tax incl.)

H-D-Ala-OtBu.HCl is an alanine derivative.

Recombinant Human COMT

Reference: P4920

€0.00 (tax incl.)

Synonyms: Catechol O methyltransferase, Catechol O-methyltransferase, COMT, COMT_HUMAN, EC 2.1.1.6. Lyophilized from a 0.2um filtered solution in PBS with 5% trehalose, pH7.4

Ceratotoxin B

Reference: HY-P1751

€0.00 (tax incl.)

Ceratotoxins B is antibacterial peptide produced by the sexually mature females of Ceratitis capitata. Lytic and antibacterial activity .

Recombinant Human BMP6

Reference: P4921

€0.00 (tax incl.)

Synonyms: BMP-6, Bmp6, BMP6_HUMAN, Bone morphogenetic protein 6, Bone Morphogenic Protein 6, Decapentaplegic vegetal related, DVR6, HGNC:12686, TGFB related vegetal related growth factor, Transforming growth factor...

J-2156

Reference: HY-111615

€0.00 (tax incl.)

J-2156 is a high potent, selective somatostatin receptor type 4 (SST4 receptor) agonist with IC50s of 0.05 nM and 0.07 nM for human and rat SST4 receptors, respectively. J-2156 is used for the relief of mechanical...

Recombinant Human PCMT1

Reference: P4922

€0.00 (tax incl.)

Synonyms: L isoaspartyl protein carboxyl methyltransferase, L isoaspartyl/D aspartyl methyltransferase, L-isoaspartyl protein carboxyl methyltransferase, PCMT 1, Pcmt1, PIMT, PIMT_HUMAN, Protein beta aspartate...

γ1-MSH TFA

Reference: HY-P1214A

€0.00 (tax incl.)

γ1-MSH TFA is a melanocortin MC3 receptor agonist, with a Ki of 34 nM for the rat MC3 receptor. γ1-MSH TFA displays ~40-fold selectivity over MC4 (Ki=1318 nM).

Recombinant Human Fibrillarin

Reference: P4923

€0.00 (tax incl.)

Synonyms: 34 kD nucleolar scleroderma antigen, 34 kDa nucleolar scleroderma antigen, Fbl, FBRL_HUMAN, FIB, FIB1, FLRN, Histone-glutamine methyltransferase, Nop1p, RNA U3 small nucleolar interacting protein 1, RNU3IP1,...

BigLEN(rat)

Reference: HY-P2155

€0.00 (tax incl.)

BigLEN(rat) is a potent GPR171 agonist with an EC50 of 1.6 nM.

Recombinant Human P cadherin

Reference: P4924

€0.00 (tax incl.)

Synonyms: CADH3_HUMAN, Cadherin 3, Cadherin 3 precursor, Cadherin 3 type 1, Cadherin-3, Cadp, Calcium dependent adhesion protein placental, CDH 3, CDH3, CDH3 protein, CDHP, HJMD, P cadherin (placental), P-cadherin,...

H-Glu-Obzl

Reference: HY-W008771

€0.00 (tax incl.)

H-Glu-Obzl is a glutamic acid derivative.

Recombinant Human PAICS

Reference: P4925

€0.00 (tax incl.)

Synonyms: ADE2, ADE2H1, AIR carboxylase, AIRC, DKFZp781N1372, MGC1343, MGC5024, Multifunctional protein ADE2, Multifunctional protein ADE2H1, Paics, PAIS, Phosphoribosylaminoimidazole carboxylase,...

H-Met-Pro-OH

Reference: HY-P4553

€0.00 (tax incl.)

H-Met-Pro-OH is a dipeptide containing methionine and proline. H-Met-Pro-OH is a substrate for aminopeptidase P (APP) and skin fibroblast prolidase.

Recombinant Human IL-10

Reference: P4926

€0.00 (tax incl.)

Synonyms: CSIF, Cytokine synthesis inhibitory factor, GVHDS, IL 10, IL-10, IL10, IL10_HUMAN, IL10A, Interleukin 10, Interleukin-10, MGC126450, MGC126451, T-cell growth inhibitory factor, TGIF. Lyophilized from a 0.2um...

Src Optimal Peptide Substrate

Reference: HY-P2513

€0.00 (tax incl.)

Src Optimal Peptide Substrate is a highly specific Src substrate. Src Optimal Peptide Substrate can used to measure the Src activity.

Recombinant Human Glutathione Peroxidase 3

Reference: P4927

€0.00 (tax incl.)

Synonyms: Extracellular glutathione peroxidase, Glutathione peroxidase 3, Glutathione peroxidase 3 (plasma), GPX 3, GPx P, GPx-3, GPx-P, GPX3, GPX3_HUMAN, GPXP, GSHPx 3, GSHPx P, GSHPx-3, GSHPx-P, Plasma glutathione...

Neuropeptide S (human)

Reference: HY-P1389

€0.00 (tax incl.)

Neuropeptide S human, a neuropeptide, is a potent cognate neuropeptide S receptor (NPSR) agonist. Neuropeptide S human can be used for Alzheimer's disease (AD) research.

Recombinant Human CCL1

Reference: P4928

€0.00 (tax incl.)

Synonyms: C-C motif chemokine 1, Ccl1, CCL1_HUMAN, Chemokine CC Motif Ligand 1, inflammatory cytokine I-309, P500, SCYA1, SISe, small inducible cytokine A1, Small-inducible cytokine A1, T lymphocyte secreted protein...

NEP(1-40)

Reference: HY-P1242

€0.00 (tax incl.)

NEP(1-40) is a Nogo-66 receptor (NgR) antagonist peptide, reversing the injury-induced shift in distribution of microglia morphologies by limiting myelin-based inhibition.

Recombinant Human NME2

Reference: P4929

€0.00 (tax incl.)

Synonyms: C myc purine binding transcription factor PUF, C myc transcription factor, C-myc purine-binding transcription factor PUF, epididymis secretory sperm binding protein Li 155an, HEL-S-155an, Histidine protein...

[D-p-Cl-Phe6,Leu17]-VIP

Reference: HY-P1159

€0.00 (tax incl.)

[D-p-Cl-Phe6,Leu17]-VIP is a competitive and selective antagonist of vasoactive intestinal peptide (VIP) receptor, with the IC50 of 125.8 nM. [D-p-Cl-Phe6,Leu17]-VIP has no activity on glucagon, secretin or GRF...

Recombinant Human USF1

Reference: P4930

€0.00 (tax incl.)

Synonyms: bHLHb11, Class B basic helix-loop-helix protein 11, FCHL, FCHL 1, FCHL1, HGNC:12593, HYPLIP 1, HYPLIP1, Major late transcription factor, Major late transcription factor 1, MLTF, MLTF I, MLTFI, Transcription...

Kaliotoxin (1-37)

Reference: HY-P3656

€0.00 (tax incl.)

Kaliotoxin (1-37) is a toxin from the scorpion Artdroctonus mauretanicus mauretanicus. Kaliotoxin (1-37) is a potent calcium-dependent potassium channel blocker.

Recombinant Human Galanin

Reference: P4931

€0.00 (tax incl.)

Synonyms: GAL, GAL 1, GAL GMAP, GAL1, GALA_HUMAN, Galanin message associated peptide, Galanin message-associated peptide, Galanin precursor, Galanin prepropeptide, Galanin related peptide, Galanin/GMAP prepropeptide,...

Z-Lys(Z)-OH

Reference: HY-W008981

€0.00 (tax incl.)

Z-Lys(Z)-OH is a lysine derivative.

Recombinant Human SPRR1b

Reference: P4932

€0.00 (tax incl.)

Synonyms: 14.9 kDa pancornulin, Cornifin, Cornifin B, Cornifin-B, CornifinB, GADD33, MGC61901, Small proline rich protein IB, Small proline-rich protein IB, SPR-IB, SPR1B_HUMAN, SPRIB, SPRR1, SPRR1B. Lyophilized from...

M1145

Reference: HY-P1135

€0.00 (tax incl.)

M1145, a chimeric peptide, is a selective galanin receptor type 2 (GAL2) agonist, with a Ki of 6.55 nM. M1145 shows more than 90-fold higher affinity for GAL2 over GAL1 (Ki=587 nM) and a 76-fold higher affinity over...

Recombinant Human Calretinin

Reference: P4933

€0.00 (tax incl.)

Synonyms: 29 kDa calbindin, CAB 29, CAB29, CAL 2, CAL2, CALB 2, CALB2, CALB2_HUMAN, Calbindin 2, Calbindin 2 29kDa, Calbindin D29K, Calbindin2, Calretinin, CR. Lyophilized from a 0.2um filtered solution in PBS with 5%...

TNF-α (10-36), human

Reference: HY-P1825

€0.00 (tax incl.)

TNF-α (10-36), human is a peptide of human TNF-α.

Recombinant Human IGFBP4

Reference: P4934

€0.00 (tax incl.)

Synonyms: AI875747, BP 4, BP4, Deb2, HT29 IGFBP, IBP 4, IBP-4, IBP4, IBP4_HUMAN, IGF binding protein 4, IGF-binding protein 4, IGF-BP4, IGFBP 4, IGFBP-4, IGFBP4, Insulin Like Growth Factor Binding Protein 4,...

Ac-DEVD-CMK

Reference: HY-P0034

€0.00 (tax incl.)

Ac-DEVD-CMK (Caspase-3 Inhibitor III) is a selective and irreversible caspase-3 inhibitor. Ac-DEVD-CMK significantly inhibits apoptosis induced by high levels of glucose or 3,20-dibenzoate (IDB; HY-137295)....

Recombinant Human Carbonic Anhydrase 4

Reference: P4935

€0.00 (tax incl.)

Synonyms: CA IV, CA4, CAH4_HUMAN, CAIV, Car4, Carbonate dehydratase IV, Carbonic anhydrase 4, Carbonic dehydratase, Carbonic dehydratase IV, EC 4.2.1.1, Retinitis pigmentosa 17 (autosomal dominant), RP17. Lyophilized...

CHIKV-IN-3

Reference: HY-144334

€0.00 (tax incl.)

CHIKV-IN-3 is a potent against two low-passage CHIKV inhibitor with EC50 values of 1.55 and 0.14 µM for CHIKV-122508 and CHIKV-6708, respectively. CHIKV-IN-3 acts on the host cells to interfere with the viral...

Recombinant Human GNLY

Reference: P4936

€0.00 (tax incl.)

Synonyms: 519, D2S69E, GNLY, GNLY_HUMAN, Granulysin, Granulysin precursor, LAG 2, LAG2, Lymphocyte activation gene 2, Lymphokine LAG 2, Lymphokine LAG-2, NKG 5, NKG5, Protein NKG5, T cell activation protein 519, T...

Fmoc-Cys(Acm)-OH

Reference: HY-W013143

€0.00 (tax incl.)

Fmoc-Cys(Acm)-OH is a cysteine derivative.

Recombinant Human AADAC

Reference: P4937

€0.00 (tax incl.)

Synonyms: AAAD_HUMAN, Aada, Aadac, Arylacetamide deacetylase, Arylacetamide deacetylase (esterase), CES5A1, DAC. Lyophilized from a 0.2um filtered solution in PBS with 5% trehalose, pH7.4

Icatibant acetate

Reference: HY-108896

€0.00 (tax incl.)

Icatibant acetate (HOE-140 acetate) is a potent and specific peptide antagonist of bradykinin B2 receptor with an IC50 and Ki of 1.07 nM and 0.798 nM respectively.

Recombinant Human Beta crystallin S

Reference: P4938

€0.00 (tax incl.)

Synonyms: AI327013, Beta-crystallin S, CRBS_HUMAN, CRYG8, crygs, Crystallin, gamma 8, Crystallin, gamma polypeptide 8, Crystallin, gamma S, CTRCT20, Gamma crystallin S, Gamma S crystallin, Gamma-crystallin S,...

Relamorelin acetate

Reference: HY-19884A

€0.00 (tax incl.)

Relamorelin (RM-131) acetate, a pentapeptide ghrelin analog, is a selective ghrelin/growth hormone secretagogue receptor (GHSR) agonist with a Ki of 0.42 nM for GHS-1a receptor. Relamorelin acetate is centrally...

Recombinant Human TCEA1

Reference: P4939

€0.00 (tax incl.)

Synonyms: GTF2S, SII, TCEA, Tcea1, TCEA1_HUMAN, TF2S, TFIIS, Transcription elongation factor A (SII) 1, Transcription elongation factor A protein 1, Transcription elongation factor A, 1, Transcription elongation...

Bombesin

Reference: HY-P0195

€0.00 (tax incl.)

Bombesin, a tetradecapeptide, plays an important role in the release of gastrin and the activation of G-protein receptors.

Recombinant Human Cyclophilin B

Reference: P4940

€0.00 (tax incl.)

Synonyms: AA408962, AA553318, AI844835, Cphn 2, Cphn2, Cyclophilin B, Cyclophilin like protein, CyP 20b, CYP S1, CYP-S1, CYPB, EC 5.2.1.8, MGC14109, MGC2224, OI9, peptidyl prolyl cis trans isomerase B, Peptidyl prolyl...

LS-BF1

Reference: HY-P3350

€0.00 (tax incl.)

LS-BF1 is a stable and low toxic cationic antimicrobial peptide. LS-BF1 displays broad spectrum of antibacterial activity, including the challenging ESKAPE pathogens, by cell membrane disruptive mechanism. LS-BF1...

Recombinant Human S100 alpha

Reference: P4941

€0.00 (tax incl.)

Synonyms: Bpb, NEF, Protein S100-A1, S-100 protein alpha chain, S-100 protein subunit alpha, S100, S100 alpha, S100 Alpha Chain, S100 Beta Chain, S100 Calcium Binding Protein A1, S100 Calcium Binding Protein B, S100...

Cys(Npys)-TAT (47-57)

Reference: HY-P4101

€0.00 (tax incl.)

Cys(Npys)-TAT (47-57) is a peptide fragment of TAT peptide and it is able to interact with plasmid DNA electrostatically. Cys(Npys)-TAT (47-57) is corresponding to the transduction domain of TAT with an activated...

Recombinant Human KAL1

Reference: P4942

€0.00 (tax incl.)

Synonyms: Adhesion molecule-like X-linked, ADMLX, Anosmin-1, HHA, KAL, KAL1, KALIG 1, KALIG1, Kallmann syndrome 1 sequence, Kallmann syndrome 1 sequence (anosmin 1), Kallmann syndrome interval gene 1, Kallmann...

Methyl 2-(2-(5-chloro-2-phenoxyphenyl)-N-methylacetamido)acetate

Reference: HY-75401

€0.00 (tax incl.)

Methyl 2-(2-(5-chloro-2-phenoxyphenyl)-N-methylacetamido)acetate is a Glycine (HY-Y0966) derivative.

Recombinant Human ME2

Reference: P4943

€0.00 (tax incl.)

Synonyms: Malate dehydrogenase, Malic enzyme 2, Malic enzyme 2 mitochondrial, Malic enzyme 2 NAD(+) dependent mitochondrial, Malic enzyme mitochondrial, Malic enzyme NAD(+) dependent mitochondrial, MAOM_HUMAN, ME 2,...

Neuropeptide Y (human)

Reference: HY-P0198

€0.00 (tax incl.)

Neuropeptide Y (human) is involved in Alzheimer's disease (AD) and protects rat cortical neurons against β-Amyloid toxicity.

Recombinant Human Tryptophanyl tRNA synthetase

Reference: P4944

€0.00 (tax incl.)

Synonyms: Gamma 2, GAMMA-2, Gamma2, hWRS, IFI 53, IFI53, IFP 53, IFP53, Interferon induced protein 53, Interferon-induced protein 53, SYWC_HUMAN, T2-TrpRS, TrpRS, Tryptophan tRNA ligase, cytoplasmic, Tryptophan tRNA...

3X FLAG peptide

Reference: HY-P0319

€0.00 (tax incl.)

3X FLAG Peptide is a synthetic peptide with a 3-time repeated DYKXXD motif.

Recombinant Human RPS3

Reference: P4945

€0.00 (tax incl.)

Synonyms: 40S ribosomal protein S3, fb13d09, FLJ26283, FLJ27450, IMR 90 ribosomal protein S3, MGC56088, MGC87870, OTTHUMP00000229804, OTTHUMP00000229805, OTTHUMP00000229874, OTTHUMP00000229877, OTTHUMP00000229878,...

Astodrimer

Reference: HY-P3626

€0.00 (tax incl.)

Astodrimer (SPL7013 free base) is a large (3-4 nm, ~ 16.5 kDa), negatively charged, highly-branched dendrimer, is a potent virucidal agent. Astodrimer shows antiviral and virucidal activity against a broad spectrum of...

Recombinant Human GCSH

Reference: P4946

€0.00 (tax incl.)

Synonyms: GCE, GCSH, GCSH_HUMAN, Glycine cleavage system H protein, Glycine cleavage system H protein mitochondrial, Glycine cleavage system protein H, Glycine cleavage system protein H (aminomethyl carrier), Lipoic...

FITC-LC-Antennapedia Peptide

Reference: HY-P4135

€0.00 (tax incl.)

FITC-LC-Antennapedia Peptide is a FITC labeled Antennapedia Peptide (HY-P0307). Antennapedia Peptide is a cellular-membrane permeable peptides (CPP). FITC-LC-Antennapedia Peptide has good penetration in 3T3 cell line,...

Category: Proteins & Peptides

Menu

Settings