Proteins & Peptides (177)

Recombinant Mouse IGF1

Reference: P4496

€0.00 (tax incl.)

Synonyms: IBP1, IGF I, IGF IA, IGF IB, IGF-I, Igf1, IGF1_HUMAN, IGF1A, IGFI, IGFIA, Insulin like growth factor 1, Insulin like growth factor 1 (somatomedin C), Insulin like growth factor IA, Insulin like growth factor...

GLP-1(7-37)

Reference: HY-P0055

€0.00 (tax incl.)

GLP-1(7-37) is an intestinal insulinotropic hormone that augments glucose induced insulin secretion.

Recombinant Human IGF1

Reference: P4497

€0.00 (tax incl.)

Synonyms: IBP1, IGF I, IGF IA, IGF IB, IGF-I, Igf1, IGF1_HUMAN, IGF1A, IGFI, IGFIA, Insulin like growth factor 1, Insulin like growth factor 1 (somatomedin C), Insulin like growth factor IA, Insulin like growth factor...

[D-Trp8,Tyr11] Somatostatin

Reference: HY-P3903

€0.00 (tax incl.)

[D-Trp8,Tyr11] Somatostatin is an analogue of somatostatin. Somatostatin is a hormone that regulates a variety of bodily functions. DTrp8 residue can increase stability.

Recombinant Human Aldolase B

Reference: P4498

€0.00 (tax incl.)

Synonyms: ALDB, ALDO B, ALDO2, ALDOB, ALDOB_HUMAN, Aldolase 2, Aldolase B, Aldolase B fructose bisphosphate, Aldolase2, AldolaseB, EC 4.1.2.13, Fructose bisphosphate aldolase B, Fructose-bisphosphate aldolase B, Liver...

2-(2-(2-Amino-4-methylpentanamido)acetamido)acetic acid

Reference: HY-W013923

€0.00 (tax incl.)

2-(2-(2-Amino-4-methylpentanamido)acetamido)acetic acid is a Glycine (HY-Y0966) derivative.

Recombinant Mouse Aldolase C

Reference: P4499

€0.00 (tax incl.)

Synonyms: ALDC, ALDO C, aldoc, ALDOC_HUMAN, Aldolase 3, Aldolase C Fructose bisphosphate, Brain type aldolase, Brain-type aldolase, Fructoaldolase C, Fructose 1 6 biphosphate triosephosphate lyase, Fructose...

[Tyr12] Somatostatin 28 (1-14)

Reference: HY-P3897

€0.00 (tax incl.)

[Tyr12] Somatostatin 28 (1-14) is an analogue of Somatostatin-28 (1-14) (HY-P1499). Somatostatin-28 (1-14) is an N-terminal fragment of the neuropeptide somatostatin-28.

Recombinant Human beta Amyloid 1-42

Reference: P4500

€0.00 (tax incl.)

Synonyms: A4, A4_HUMAN, AAA, ABETA, ABPP, AICD-50, AICD-57, AICD-59, AID(50), AID(57), AID(59), Alzheimer disease amyloid protein, Amyloid intracellular domain 50, Amyloid intracellular domain 57, Amyloid...

OVA G4 peptide TFA

Reference: HY-P1771A

€0.00 (tax incl.)

OVA G4 peptide TFA is a variant of the agonist ovalbumin (OVA) peptide SIINFEKL (257-264). SIINFEKL is routinely used to stimulate ovalbumin-specific T cells and to test new vaccine adjuvants can form a stable hydrogel.

Recombinant Human Amyloid Precursor

Reference: P4501

€0.00 (tax incl.)

Synonyms: A4 amyloid protein, A4_HUMAN, AAA, ABETA, ABPP, AD1, AICD-50, AICD-57, AICD-59, AID(50), AID(57), AID(59), Alzheimer disease amyloid protein, Amyloid beta (A4) precursor protein, Amyloid beta A4 protein,...

ω-Conotoxin GVIA TFA

Reference: HY-P0189A

€0.00 (tax incl.)

ω-Conotoxin GVIA TFA is an inhibitor of the N-type Ca2+ channel.

Recombinant Human Liver Arginase

Reference: P4502

€0.00 (tax incl.)

Synonyms: A I, Al, ARG 1, arg1, ARGI1_HUMAN, Arginase 1, Arginase liver, Arginase type I, Arginase, liver, Arginase-1, Arginase1, Liver type arginase, Liver-type arginase, Type I arginase. Lyophilized from a 0.2um...

Notch 1 TFA

Reference: HY-P1985A

€0.00 (tax incl.)

Notch 1 TFA (Notch homolog 1, translocation-associated) can encode a member of the NOTCH family of proteins. Members of this Type I transmembrane protein family share structural characteristics including an...

Recombinant Human ALDH2

Reference: P4503

€0.00 (tax incl.)

Synonyms: Acetaldehyde dehydrogenase 2, Aldehyde dehydrogenase 2 family, Aldehyde dehydrogenase 2 family (mitochondrial), Aldehyde dehydrogenase mitochondrial, Aldehyde dehydrogenase, mitochondrial, ALDH 2, ALDH class...

Boc-Arg(di-Z)-OH

Reference: HY-W013097

€0.00 (tax incl.)

Boc-Arg(di-Z)-OH can be used for the synthesis of amino acid. Boc-Arg(di-Z)-OH can be used for the research of inhibitors for processing proteinases. Boc-Arg(di-Z)-OH is coupled via the mixed anhydride (MA) with...

Recombinant Human MRP8

Reference: P4504

€0.00 (tax incl.)

Synonyms: 60B8Ag, AI323541, B8Ag, BEE11, CAGA, Calgranulin-A, Calprotectin L1L subunit, Calprotectin, included, CFAG, CGLA, Chemotactic cytokine CP-10, CP-10, Cystic fibrosis antigen, L1Ag, Leukocyte L1 complex light...

Orexin A (human, rat, mouse) (acetate)

Reference: HY-106224B

€0.00 (tax incl.)

Orexin A (Hypocretin-1) (human, rat, mouse) acetate is a hypothalamic neuropeptide with analgesic properties (crosses the blood-brain barrier). Orexin A (human, rat, mouse) acetate is also an OX1R agonist that induces...

Recombinant Human IL-4

Reference: P4505

€0.00 (tax incl.)

Synonyms: B cell growth factor 1, B cell IgG differentiation factor, B Cell Stimulatory Factor 1, B-cell stimulatory factor 1, BCGF 1, BCGF1, Binetrakin, BSF-1, BSF1, IGG1 induction factor, IL 4, IL-4, IL4, IL4_HUMAN,...

Neuropeptide FF

Reference: HY-P1248

€0.00 (tax incl.)

Neuropeptide FF (NPFF), an octapeptide belonging to the RF-amide family of peptides, interacts with two distinct G-protein-coupled receptors, NPFF(1) and NPFF(2) and has wide variety of physiological functions in the...

Recombinant Human IL-5

Reference: P4506

€0.00 (tax incl.)

Synonyms: B-cell differentiation factor I, Colony stimulating factor, EDF, Eosinophil differentiation factor, IL-5, IL5, IL5_HUMAN, Interleukin 5, Interleukin 5 (colony stimulating factor, eosinophil), Interleukin-5,...

GPLGIAGQ TFA

Reference: HY-P2213A

€0.00 (tax incl.)

GPLGIAGQ TFA, a MMP2-cleavable polypeptide, is used as a stimulus-sensitive linker in both liposomal and micellar nanocarriers for MMP2-triggered tumor targeting. GPLGIAGQ TFA can be used to synthesis unique...

Recombinant Human SerpinB2

Reference: P4507

€0.00 (tax incl.)

Synonyms: HsT1201, Monocyte Arg serpin, Monocyte Arg-serpin, Monocyte Arginine-serpin, Monocyte-derived plasminogen activator inhibitor, PAI, PAI-2, PAI2, PAI2_HUMAN, Placental plasminogen activator inhibitor, PLANH2,...

Dynamin inhibitory peptide TFA

Reference: HY-P1083A

€0.00 (tax incl.)

Dynamin inhibitory peptide TFA competitively blocks binding of dynamin to amphiphysin, thus preventing endocytosis. Dynamin inhibitory peptide TFA blocks the dopamine D3 effect on GABAA receptors.

Recombinant Human Serpin A5

Reference: P4508

€0.00 (tax incl.)

Synonyms: Acrosomal serine protease inhibitor, IPSP, IPSP_HUMAN, PAI 3, PAI-3, PAI3, PCI, PCI-B, PLANH 3, PLANH3, Plasma serine protease inhibitor, Plasminogen activator inhibitor 3, Plasminogen activator inhibitor...

Amyloid β-Protein (33-42) (TFA)

Reference: HY-P3793

€0.00 (tax incl.)

Amyloid β-Protein (33-42) TFA is the residues 33-42 fragment of the β-amyloid protein. Amyloid β-Protein (33-42) TFA inhibits Aβ42-induced toxicity.

Recombinant Human Galectin 2

Reference: P4509

€0.00 (tax incl.)

Synonyms: Beta galactoside binding lectin L14 II, Beta-galactoside-binding lectin L-14-II, CBP35, Gal-2, GAL3, GALBP, Galectin 2, Galectin-2, GALIG, HL14, Lactose binding lectin 2, Lactose-binding lectin 2,...

LQVTDSGLYRCVIYHPP

Reference: HY-P3400

€0.00 (tax incl.)

LQVTDSGLYRCVIYHPP (LP17) is a triggering receptor expressed on myeloid cells (TREM-1) inhibitory peptide. LQVTDSGLYRCVIYHPP substantially alleviates ischemia-induced infarction and neuronal injury. LQVTDSGLYRCVIYHPP...

Recombinant Human PCCB

Reference: P4510

€0.00 (tax incl.)

Synonyms: DKFZp451E113, PCCase subunit beta, pccB, PCCB_HUMAN, pccBC Complementation group, Propanoyl CoA:carbon dioxide ligase subunit beta, Propanoyl-CoA:carbon dioxide ligase subunit beta, Propionyl CoA carboxylase...

(S)-2-((((9H-Fluoren-9-yl)methoxy)carbonyl)(methyl)amino)-4-oxo-4-(tritylamino)butanoic acid

Reference: HY-W130397

€0.00 (tax incl.)

(S)-2-((((9H-Fluoren-9-yl)methoxy)carbonyl)(methyl)amino)-4-oxo-4-(tritylamino)butanoic acid is an asparagine derivative.

Recombinant Human eIF2A

Reference: P4511

€0.00 (tax incl.)

Synonyms: 65 kDa eukaryotic translation initiation factor 2A, CDA 02, CDA02, EIF 2, EIF 2A, eIF-2A, EIF2, eif2a, EIF2A_HUMAN, Eukaryotic translation initiation factor 2A, Eukaryotic translation initiation factor 2A...

D-Histidine monohydrochloride monohydrate

Reference: HY-W142156

€0.00 (tax incl.)

D-Histidine monohydrochloride monohydrate is a histidine derivative.

Recombinant Mouse Aspartate Aminotransferase

Reference: P4512

€0.00 (tax incl.)

Synonyms: AATC_HUMAN, Aspartate aminotransferase, Aspartate aminotransferase 1, Aspartate aminotransferase cytoplasmic, Aspartate aminotransferase cytosolic, ASTQTL1, cAspAT, cCAT, cysteine aminotransferase,...

Z-WEHD-FMK

Reference: HY-P0111

€0.00 (tax incl.)

Z-WEHD-FMK is a potent, cell-permeable and irreversible caspase-1/5 inhibitor. Z-WEHD-FMK also exhibits a robust inhibitory effect on cathepsin B activity (IC50=6 μM). Z-WEHD-FMK can be used to investigate cells for...

Recombinant Mouse CELA2A

Reference: P4513

€0.00 (tax incl.)

Synonyms: CEL2A_HUMAN, Cela2a, Chymotrypsin-like elastase family member 2A, Elastase-2A. Lyophilized from a 0.2um filtered solution in PBS with 5% trehalose, pH7.4

TRV-120027 TFA

Reference: HY-P2141A

€0.00 (tax incl.)

TRV120027 TFA, a β-arrestin-1-biased agonist of the angiotensin II receptor type 1 (AT1R), engages ß-arrestins while blocking G-protein signaling. TRV120027 TFA induces acute catecholamine secretion through cation...

Recombinant Human FGF1

Reference: P4514

€0.00 (tax incl.)

Synonyms: Acidic fibroblast growth factor, aFGF, Beta endothelial cell growth factor, Beta-endothelial cell growth factor, ECGF, ECGF beta, ECGF-beta, ECGFA, ECGFB, Endothelial Cell Growth Factor alpha, Endothelial...

Myomodulin

Reference: HY-P0268

€0.00 (tax incl.)

Myomodulin is a neuropeptide present in molluscs, insects, and gastropods.

Recombinant Human FGF1 alpha

Reference: P4515

€0.00 (tax incl.)

Synonyms: Acidic fibroblast growth factor, aFGF, Beta-endothelial cell growth factor, ECGF-beta, Endothelial cell growth factor, Fgf1, FGF1_HUMAN, HBGF-1, Heparin-binding growth factor 1. Lyophilized from a 0.2um...

Hemokinin 1 (mouse)

Reference: HY-P1030

€0.00 (tax incl.)

Hemokinin 1 (mouse) is a selective agonist of neurokinin-1 receptor, with Ki of 0.175 nM and 560 nM for human NK1 receptor and human NK2 receptor, respectively.

Recombinant Human IL-6

Reference: P4516

€0.00 (tax incl.)

Synonyms: Interleukin BSF 2, B cell differentiation factor, B cell stimulatory factor 2, B-cell stimulatory factor 2, BSF 2, BSF-2, BSF2, CDF, CTL differentiation factor, Cytotoxic T cell differentiation factor,...

PACAP (6-38), human, ovine, rat TFA

Reference: HY-P0220A

€0.00 (tax incl.)

PACAP (6-38), human, ovine, rat TFA is a potent PACAP receptor antagonist with IC50s of 30, 600, and 40 nM for PACAP type I receptor, PACAP type II receptor VIP1, and PACAP type II receptor VIP2, respectively.

Recombinant Mouse SAA1

Reference: P4517

€0.00 (tax incl.)

Synonyms: amyloid A, serum, Amyloid fibril protein AA, Amyloid protein A, MGC111216, PIG4, SAA, SAA2, Serum amyloid A protein, serum amyloid A-1 protein, serum amyloid A1, TP53I4, Tumor protein p53 inducible protein...

RGD Trifluoroacetate

Reference: HY-P0278A

€0.00 (tax incl.)

RGD Trifluoroacetate is a tripeptide that effectively triggers cell adhesion, addresses certain cell lines and elicits specific cell responses; RGD Trifluoroacetate binds to integrins.

Recombinant Human RPLP2

Reference: P4518

€0.00 (tax incl.)

Synonyms: 2700049I22Rik, 60S acidic ribosomal protein P2, Acidic ribosomal phosphoprotein P2, D11S2243E, LP2, MGC71408, OTTMUSP00000029428, OTTMUSP00000029429, OTTMUSP00000029430, P2, Renal carcinoma antigen...

N-Benzylglycine hydrochloride

Reference: HY-Y0735

€0.00 (tax incl.)

N-Benzylglycine hydrochloride is a Glycine (HY-Y0966) derivative.

Recombinant Human RPLP0

Reference: P4519

€0.00 (tax incl.)

Synonyms: 36B4, 60S acidic ribosomal protein P0, 60S ribosomal protein L10E, Acidic ribosomal phosphoprotein P0, Arbp, L10E, LP0, MGC107165, MGC107166, MGC111226, MGC88175, OTTMUSP00000015585, P0, PRLP0, Ribosomal...

tert-Butoxycarbonyl-D-valine

Reference: HY-41060

€0.00 (tax incl.)

tert-Butoxycarbonyl-D-valine is a valine derivative.

Recombinant Human Secretogranin V

Reference: P4520

€0.00 (tax incl.)

Synonyms: 7B2, 7B2 protein, APPG, Neuroendocrine protein 7B2, P7B2, Pituitary polypeptide, Prohormone convertase chaperone, SCG 5, SCG5, Secretogranin 5, Secretogranin V 7B2 protein, Secretogranin5, SecretograninV,...

(R)-Ethyl 2-((tert-butoxycarbonyl)amino)-3-hydroxypropanoate

Reference: HY-W022536

€0.00 (tax incl.)

(R)-Ethyl 2-((tert-butoxycarbonyl)amino)-3-hydroxypropanoate is a serine derivative.

Recombinant Human c-Jun

Reference: P4521

€0.00 (tax incl.)

Synonyms: Activator protein 1, AP 1, AP-1, AP1, cJun, Enhancer Binding Protein AP1, JUN, Jun Activation Domain Binding Protein, Jun oncogene, JUN protein, Jun proto oncogene, JUN_HUMAN, JUNC, Oncogene JUN, p39, Proto...

Boc-Ala-OMe

Reference: HY-W002173

€0.00 (tax incl.)

Boc-Ala-OMe is an alanine derivative.

Recombinant Human H-FABP

Reference: P4522

€0.00 (tax incl.)

Synonyms: 422 protein, Cardiac FABP, Cardiac Fatty Acid Binding Protein, FABP 11, FABP 3, FABP11, FABP3, FABPH_HUMAN, Fatty acid binding protein 11, Fatty acid binding protein 3, Fatty acid binding protein 3 muscle,...

Fmoc-3-Pal-OH

Reference: HY-W011020

€0.00 (tax incl.)

Fmoc-3-Pal-OH is an alanine derivative.

Recombinant Human SSB

Reference: P4523

€0.00 (tax incl.)

Synonyms: Autoantigen La, La, La autoantigen, La autoantigen homolog, La protein, La ribonucleoprotein, La ribonucleoprotein domain family member 3, LA_HUMAN, LARP3, Lupus La antigen, Lupus La protein, Lupus La...

HBV Seq2 aa:179-186

Reference: HY-P4046

€0.00 (tax incl.)

HBV Seq2 aa:179-186 serve as effective motifs for CTL response in H-2b system after in vitro restimulation of the primed T cells. HBV Seq2 aa:179-186 is a novel epitope identified on the surface antigen of hepatitis B...

Recombinant Human Cytokeratin 18

Reference: P4524

€0.00 (tax incl.)

Synonyms: Cell proliferation inducing gene 46 protein, Cell proliferation inducing protein 46, Cell proliferation-inducing gene 46 protein, CK 18, CK-18, CK18, CYK 18, CYK18, Cytokeratin 18, Cytokeratin endo B,...

Angiotensin amide

Reference: HY-P2212

€0.00 (tax incl.)

Angiotensin amide ((Asn1,Val5)-Angiotensin II) is a potent vasoconstrictor. Angiotensin amide is a derivative of angiotensin II. Angiotensin amide can be used as a cardiac stimulant.

Recombinant Human Cytokeratin 8

Reference: P4525

€0.00 (tax incl.)

Synonyms: CARD2, CK 8, CK-8, CK8, CYK8, CYKER, Cytokeratin endo A, Cytokeratin-8, DreK8, EndoA, K2C8, K2C8_HUMAN, K8, Keratin 8, Keratin type II cytoskeletal 8, Keratin, type II cytoskeletal 8, Keratin-8, KO, Krt 2.8,...

Fmoc-D-Phe(2,4-Cl2)-OH

Reference: HY-W141817

€0.00 (tax incl.)

Fmoc-D-Phe(2,4-Cl2)-OH is a phenylalanine derivative.

Recombinant Human beta Casein

Reference: P4526

€0.00 (tax incl.)

Synonyms: Beta-casein, CASB, CASB_HUMAN, Casein beta, CSN 2, Csn2. Lyophilized from a 0.2um filtered solution in PBS with 5% trehalose, pH7.4

Boc-Thr(Me)-OH

Reference: HY-W018650

€0.00 (tax incl.)

Boc-Thr(Me)-OH is a threonine derivative.

Recombinant Human UPD

Reference: P4527

€0.00 (tax incl.)

Synonyms: DCUP_HUMAN, PCT, UPD, URO D, URO-D, urod, Uroporphyrinogen decarboxylase, Uroporphyrinogen III decarboxylase. Lyophilized from a 0.2um filtered solution in PBS with 5% trehalose, pH7.4

Cyclosporin A-Derivative 1

Reference: HY-P1355

€0.00 (tax incl.)

Cyclosporin A-Derivative 1 is a crystalline intermediate derived from the opening of cyclosporin A extracted from patent WO 2013167703 A1. Cyclosporin A is an immunosuppressive agent which can bind to the cyclophilin...

Recombinant Human Insulin Receptor

Reference: P4528

€0.00 (tax incl.)

Synonyms: CD220, HHF5, human insulin receptor, Insr, INSR_HUMAN, Insulin receptor subunit beta, IR, IR 1, IR-1, IR1. Lyophilized from a 0.2um filtered solution in PBS with 5% trehalose, pH7.4

LXW7

Reference: HY-P0178

€0.00 (tax incl.)

LXW7, a cyclic peptide containing Arg-Gly-Asp (RGD), is an integrin αvβ3 inhibitor. LXW7 has a high binding affinity to αvβ3 integrin with an IC50 of 0.68 μM. LXW7 increases phosphorylation of VEGFR-2 and activation...

Recombinant Human Rb

Reference: P4529

€0.00 (tax incl.)

Synonyms: Exon 17 tumor GOS561 substitution mutation causes premature stop, GOS563 exon 17 substitution mutation causes premature stop, OSRC, Osteosarcoma, p105-Rb, P105RB, PP105, pp110, PPP1R130, pRb, Prepro...

Insulin-like growth factor II

Reference: HY-P4061

€0.00 (tax incl.)

Insulin-like growth factor II (IGF-2) is the principal somatomedin of human serum. Insulin-like growth factor II exerts permissive and direct effects on neurite outgrowth and enhances survival of sympathetic and...

Recombinant Human PTMA

Reference: P4530

€0.00 (tax incl.)

Synonyms: Gene sequence 28, Prothymosin alpha, Prothymosin alpha protein, TMSA. Lyophilized from a 0.2um filtered solution in PBS with 5% trehalose, pH7.4

Z-Aib-OH

Reference: HY-W012137

€0.00 (tax incl.)

Z-Aib-OH is an alanine derivative.

Recombinant Mouse HBZ

Reference: P4531

€0.00 (tax incl.)

Synonyms: HBAZ, HBAZ_HUMAN, HBZ, HBZ 2, HBZ2, Hemoglobin subunit zeta, Hemoglobin zeta, Hemoglobin zeta chain, Zeta globin, Zeta-globin. Lyophilized from a 0.2um filtered solution in PBS with 5% trehalose, pH7.4

N-Myristoyl-Lys-Arg-Thr-Leu-Arg

Reference: HY-P3083

€0.00 (tax incl.)

N-Myristoyl-Lys-Arg-Thr-Leu-Arg is a protein kinase C (PKC) inhibitor with an IC50 value of 75 μM. N-Myristoyl-Lys-Arg-Thr-Leu-Arg inhibits IL-2 receptor induction and IL-2 production in the human leukemic cell line...

Recombinant Rat ErbB 2

Reference: P4532

€0.00 (tax incl.)

Synonyms: Verb b2 erythroblastic leukemia viral oncogene homolog 2, neuro/glioblastoma derived oncogene homolog, C erb B2/neu protein, CD340, CD340 antigen, Cerb B2/neu protein, CerbB2, Erb b2 receptor tyrosine kinase...

Lactalbumin B (50-53) Alpha [Lactorphin Alpha], bovine

Reference: HY-P3976

€0.00 (tax incl.)

Lactalbumin B (50-53) Alpha [Lactorphin Alpha], bovine is a blood pressure lowering peptide containing 4 amino acids. Lactalbumin B (50-53) Alpha [Lactorphin Alpha], bovine is an angiotensin-converting Enzyme (ACE)...

Recombinant Human ATPB

Reference: P4533

€0.00 (tax incl.)

Synonyms: ATP 5B, ATP synthase H+ transporting mitochondrial F1 complex beta polypeptide, ATP synthase subunit beta mitochondrial, ATP synthase subunit beta, mitochondrial, atp5b, ATPB, ATPB_HUMAN, ATPMB, ATPSB,...

Ederimotide

Reference: HY-P3058

€0.00 (tax incl.)

Ederimotide(WT-1 A1) can be used as a potential target for studying pancreatic cancer.

Recombinant Mouse C5

Reference: P4534

€0.00 (tax incl.)

Synonyms: Anaphylatoxin C5a analog, C3 and PZP-like alpha-2-macroglobulin domain-containing protein 4, C5, C5a, CO5_HUMAN, Complement C5, Complement C5 alpha'' chain, Complement component C5, CPAMD4. Lyophilized from...

STIEEQAKTFLDKFNHEAEDLFYQSSLASWN

Reference: HY-P3141

€0.00 (tax incl.)

STIEEQAKTFLDKFNHEAEDLFYQSSLASWN, an angiotensin-converting enzyme 2 (ACE2) related peptide, can be used to study the function of ACE2.

Recombinant Human S100A9

Reference: P4535

€0.00 (tax incl.)

Synonyms: Leukocyte L1 complex heavy chain, 60B8AG, CAGB, Calgranulin B, Calgranulin-B, Calprotectin L1H subunit, CFAG, CGLB, Cystic fibrosis antigen B, L1AG, Leukocyte L1 complex heavy chain, LIAG, MAC387, MIF,...

Vosoritide acetate

Reference: HY-P3503A

€0.00 (tax incl.)

Vosoritide (BMN 111) acetate is a natriuretic peptide receptor 2 (NPR2) agonist that acts on the proliferation and differentiation of chondrocytes to promote bone growth.

Recombinant Human S100 alpha 6

Reference: P4536

€0.00 (tax incl.)

Synonyms: 2A9, 5B10, CABP, CACY, Calcyclin, Growth factor inducible protein 2A9, Growth factor-inducible protein 2A9, MLN 4, MLN4, OTTHUMP00000015472, OTTHUMP00000015473, PRA, PRAGrowth factor inducible protein 2A9,...

Thioredoxin reductase peptide TFA

Reference: HY-P1948A

€0.00 (tax incl.)

Thioredoxin reductase peptide TFA corresponds to residues 53–67 in thioredoxin reductase (TrxR), used in thioredoxin reductase research. Thioredoxin reductase acts as a reductant of disulfide-containing proteins and...

Recombinant Human gor

Reference: P4537

€0.00 (tax incl.)

Synonyms: ECK3485, glutathione oxidoreductase, Glutathione reductase, gor, gorA, GR, GRase, GSHR_ECOLI, JW3467. Lyophilized from a 0.2um filtered solution in PBS with 5% trehalose, pH7.4

Fmoc-Leu-Ser(psi(Me,Me)pro)-OH

Reference: HY-P2390

€0.00 (tax incl.)

Fmoc-Leu-Ser(psi(Me,Me)pro)-OH is a dipeptide.

Recombinant Human CD2

Reference: P4538

€0.00 (tax incl.)

Synonyms: CD 2, CD2, CD2 antigen, CD2 antigen (p50), sheep red blood cell receptor, CD2 molecule, CD2_HUMAN, Erythrocyte receptor, FLJ46032, LFA-2, LFA-3 receptor, LFA2, LFA3 receptor, Ly-37, Lymphocyte function...

2-((tert-Butoxycarbonyl)amino)-2-cyclohexylacetic acid

Reference: HY-W021790

€0.00 (tax incl.)

2-((tert-Butoxycarbonyl)amino)-2-cyclohexylacetic acid is a Glycine (HY-Y0966) derivative.

Recombinant Human Creatine Kinase MM

Reference: P4539

€0.00 (tax incl.)

Synonyms: CKM, CKMM, Creatine kinase M, Creatine kinase M chain, Creatine kinase M type, Creatine kinase M-type, Creatine kinase muscle, Creatine kinase, muscle type, KCRM_HUMAN, M-CK, MCK, Muscle creatine kinase....

TP508

Reference: HY-P0316

€0.00 (tax incl.)

TP508 is a 23-amino acid nonproteolytic thrombin peptide that represents a portion of the receptor-binding domain of thrombin molecule. TP508 activates endothelial NO synthase (eNOS) and stimulates production of NO in...

Recombinant Human ENO1

Reference: P4540

€0.00 (tax incl.)

Synonyms: 2 phospho D glycerate hydro lyase, 2-phospho-D-glycerate hydro-lyase, Alpha enolase, Alpha enolase like 1, Alpha-enolase, C myc promoter binding protein, C-myc promoter-binding protein, EC 4.2.1.11, eno1,...

[Ala2] Endothelin-3, human

Reference: HY-P3571

€0.00 (tax incl.)

[Ala2] Endothelin-3, human is a linear analog of endothelin-3 (ET-3) where substitution of Ala for Cys residues. TE-3 is a vasoactive peptide, produced by human rhabdomyosarcoma cell lines, whereas it is not expressed...

Recombinant Human AMF Bioactivity Validated

Reference: P4541

€0.00 (tax incl.)

Synonyms: AMF, Aurocrine motility factor, Autocrine motility factor, DKFZp686C13233, EC 5.3.1.9, G6PI_HUMAN, Glucose phosphate isomerase, Glucose-6-phosphate isomerase, GNPI, GPI, Gpi1, Hexose monophosphate isomerase,...

γ-Glu-Gly

Reference: HY-P3280

€0.00 (tax incl.)

γ-Glu-Gly, a γ-glutamyl dipeptide, is a human lipid metabolite.γ-Glu-Gly has a similar structure to GABA (γ-aminobutyric acid) and can act as an antagonist of excitatory amino acids.

Recombinant Human DNA Polymerase beta

Reference: P4542

€0.00 (tax incl.)

Synonyms: DNA directed DNA polymerase beta, DNA pol beta, DNA polymerase beta, DNA polymerase beta subunit, DPOLB_HUMAN, MGC125976, Pol B, Pol beta, POLB, Polymerase (DNA directed) beta. Lyophilized from a 0.2um...

Protein kinase C (alpha) peptide TFA

Reference: HY-P3766

€0.00 (tax incl.)

Protein kinase C (alpha) peptide (TFA) is a peptide of PKC-α. PKC-α acts as a lipid-dependent ser/thr protein kinase, can modulate various cellular processes, including cell survival, proliferation, differentiation,...

Recombinant Human Nucleophosmin

Reference: P4543

€0.00 (tax incl.)

Synonyms: B23, MGC104254, NO38, NPM, NPM_HUMAN, NPM1, Nucleolar phosphoprotein B23, Nucleolar protein NO38, Nucleophosmin, Nucleophosmin (nucleolar phosphoprotein B23 numatrin), nucleophosmin nucleoplasmin family...

Omiganan

Reference: HY-105048

€0.00 (tax incl.)

Omiganan is a cationic antimicrobial peptide. Omiganan as an analogue of indolicidin shows activity against gram-positive and gram-negative bacteria but also Candida spp. isolates. Omiganan can be used for the...

Recombinant Human Tropomyosin 3

Reference: P4544

€0.00 (tax incl.)

Synonyms: Alpha tropomyosin 3, Alpha tropomyosin slow skeletal, CFTD, Cytoskeletal tropomyosin TM30, FLJ41118, gamma TM, Gamma tropomyosin, Gamma-tropomyosin, Heat stable cytoskeletal protein 30 kDa, hscp30, hTM30nm,...

Endothelin-1 (1-31) (Human) TFA

Reference: HY-P4159A

€0.00 (tax incl.)

Endothelin-1 (1-31) (Human) TFA is a potent vasoconstrictor and hypertensive agent. Endothelin-1 (1-31) (Human) TFA is derived from the selective hydrolysis of big ET-1 by chymase.

Recombinant Rat Heme Oxygenase 1

Reference: P4545

€0.00 (tax incl.)

Synonyms: 32 kD, bK286B10, D8Wsu38e, Heat shock protein, heat shock protein 32 kD, heat shock protein 32kD, Heme oxygenase (decycling) 1, Heme oxygenase 1, Hemox, Hmox, HMOX 1, Hmox1, HMOX1_HUMAN, HO, HO 1, HO-1, HO1,...

Cyclosporin A-Derivative 1 Free base

Reference: HY-P1355A

€0.00 (tax incl.)

Cyclosporin A-Derivative 1 (Free base) is a crystalline intermediate derived from the opening of cyclosporin A extracted from patent WO 2013167703 A1. Cyclosporin A is an immunosuppressive agent which can bind to the...

Category: Proteins & Peptides

Menu

Settings