Proteins & Peptides (168)

DA-JC4

Reference: HY-P3255

€0.00 (tax incl.)

DA-JC4 is a dual GLP-1/GIP receptor agonist and can be used for the research of neurological disease and insulin signaling pathways.

Synonyms: Adapter related protein complex 3 beta 1 subunit, Adapter-related protein complex 3 subunit beta-1, Adaptor protein complex AP-3 subunit beta-1, Adaptor protein complex AP3 beta1 subunit, ADTB3, ADTB3A, AP-3...

N-(((9H-Fluoren-9-yl)methoxy)carbonyl)-S-methyl-L-cysteine

Reference: HY-W048708

€0.00 (tax incl.)

N-(((9H-Fluoren-9-yl)methoxy)carbonyl)-S-methyl-L-cysteine is a cysteine derivative.

Recombinant Human SULT2B1

Reference: P4038

€0.00 (tax incl.)

Synonyms: Alcohol sulfotransferase, EC 2.8.2.2, HSST2, Hydroxysteroid sulfotransferase 2, ST2B1, ST2B1_HUMAN, Sulfotransferase 2B1, Sulfotransferase family cytosolic 2B member 1, SULT2B1, SULT2B1a, SULT2B1b....

Fmoc-Ile-OH

Reference: HY-19821

€0.00 (tax incl.)

Fmoc-Ile-OH is an isoleucine derivative.

Recombinant Human RHOD

Reference: P4039

€0.00 (tax incl.)

Synonyms: ARHD, Ras homolog D, Ras homolog gene family member A, Ras homolog gene family member D, Rho, RHO D, Rho related GTP binding protein RhoD, Rho related protein HP1, Rho-related GTP-binding protein RhoD,...

Sincalide ammonium

Reference: HY-P0093A

€0.00 (tax incl.)

Sincalide ammonium (Cholecystokinin octapeptide ammonium, CCK-8 ammonium) is a rapid-acting amino acid polypeptide hormone analogue of cholecystokinin (CCK) for intravenous use in postevacuation cholecystography....

Recombinant Human Galectin 8

Reference: P4040

€0.00 (tax incl.)

Synonyms: Gal 8, Gal-8, Gal8, Galectin 8, Galectin-8, galectin-8g, Lectin galactoside binding soluble 8, LEG8_HUMAN, LGAL S8, Lgals8, PCTA 1, PCTA-1, PCTA1, Po66 carbohydrate binding protein, Po66 carbohydrate-binding...

Cyclo(-RGDfK)

Reference: HY-P0023

€0.00 (tax incl.)

Cyclo(-RGDfK) is a potent and selective inhibitor of the αvβ3 integrin, with an IC50 of 0.94 nM. Cyclo(-RGDfK) TFA potently targets tumor microvasculature and cancer cells through the specific binding to the αvβ3...

Recombinant Human PSMD9

Reference: P4041

€0.00 (tax incl.)

Synonyms: 26S proteasome non ATPase regulatory subunit 9, 26S proteasome non-ATPase regulatory subunit 9, 26S proteasome regulatory subunit p27, Homolog of rat Bridge 1, MGC8644, p27, Proteasome (prosome macropain)...

HPV16 E7 (86-93)

Reference: HY-P1778

€0.00 (tax incl.)

HPV16 E7 (86-93) is a human leukocyte antigen (HLA)-A2.1 restricted HPV16 E7-derived peptide. HPV16 E7 (86-93) is immunogenic in cervical carcinomas.

Recombinant Human ATOX1

Reference: P4042

€0.00 (tax incl.)

Synonyms: ATOX1, ATOX1_HUMAN, ATX1, ATX1 antioxidant protein 1 homolog, ATX1 antioxidant protein 1 homolog (yeast), Copper transport protein, Copper transport protein ATOX1, HAH1, Metal transport protein, Metal...

Trilysine

Reference: HY-W009004

€0.00 (tax incl.)

Trilysine is sourced from L-lysine .

Recombinant Human AGRP

Reference: P4043

€0.00 (tax incl.)

Synonyms: Agouti related neuropeptide, Agouti Related Protein Homolog, Agouti-related protein, Agrp, AGRP_HUMAN, AGRT, ART, ASIP2. Lyophilized from a 0.2um filtered solution in PBS with 5% trehalose, pH7.4

Gap 26 TFA

Reference: HY-P1082A

€0.00 (tax incl.)

Gap 26 TFA is a connexin mimetic peptide, composed of residue numbers 63-75 of the first extracellular loop of connexin 43 (gap junction blocker), containing the SHVR amino acid motif.

Recombinant Human ICAD

Reference: P4044

€0.00 (tax incl.)

Synonyms: A330085O09Rik, Caspase activated deoxyribonuclease inhibitor short form, DFF 1, DFF 45, DFF alpha, DFF-45, DFF1, DFF35, DFF45, DFFA, Dffa DNA fragmentation factor, alpha subunit, DFFA_HUMAN, DNA...

Cys-Kemptide

Reference: HY-P3920

€0.00 (tax incl.)

Cys-Kemptide is a cysteine-terminated substrate peptide that can used to measure protein kinase A (PKA) activity.

Recombinant Human TULP1

Reference: P4045

€0.00 (tax incl.)

Synonyms: RP14, Tubby like protein 1, Tubby related protein 1, Tubby related protein 1 (Tubby like protein 1), Tubby-like protein 1, Tubby-related protein 1, TUBL1, TULP 1, Tulp1, TULP1_HUMAN. Lyophilized from a 0.2um...

C3bot(154-182) TFA

Reference: HY-P1243A

€0.00 (tax incl.)

C3bot(154-182) TFA is a C3 peptide enhances recovery from spinal cord injury by improving regenerative growth of descending fiber tracts. C3bot(154-182) TFA represents a promising tool to foster axonal protection...

Recombinant Human TULP2

Reference: P4046

€0.00 (tax incl.)

Synonyms: Cancer testis antigen 65, Cancer/testis antigen 65, CT65, MGC107290, Pdet, Protein P4-6, Tubby like protein 2, Tubby related protein 2, Tubby-like protein 2, Tubby-related protein 2, TUBL 2, TUBL2, TULP 2,...

Tyr-Somatostatin-14

Reference: HY-P1600

€0.00 (tax incl.)

Tyr-Somatostatin-14 is a customized peptide that adds a Tyrosine amino acid to Somatostatin-14.

Recombinant Human Osteoprotegerin

Reference: P4047

€0.00 (tax incl.)

Synonyms: MGC29565, OCIF, OPG, Osteoclastogenesis inhibitory factor, Osteoprotegerin, PDB5, TNF receptor superfamily member 11b, TNFRSF 11B, TNFRSF11B, TR 1, TR1, TR11B_HUMAN, Tumor necrosis factor receptor...

H-allo-Thr(tBu)-OH

Reference: HY-W051351

€0.00 (tax incl.)

H-allo-Thr(tBu)-OH is a threonine derivative.

Recombinant Human PDHX

Reference: P4048

€0.00 (tax incl.)

Synonyms: Dihydrolipoamide dehydrogenase binding protein of pyruvate dehydrogenase complex, Dihydrolipoamide dehydrogenase-binding protein of pyruvate dehydrogenase complex, DLDBP, E3 binding protein, E3-binding...

Substance P

Reference: HY-P0201

€0.00 (tax incl.)

Substance P (Neurokinin P) is a neuropeptide, acting as a neurotransmitter and as a neuromodulator in the CNS. The endogenous receptor for substance P is neurokinin 1 receptor (NK1-receptor, NK1R).

Recombinant Human SULT1C2

Reference: P4049

€0.00 (tax incl.)

Synonyms: humSULTC2, ST1C1, ST1C2, ST1C2_HUMAN, Sulfotransferase 1C1, Sulfotransferase 1C2, Sulfotransferase family cytosolic 1C member 1, Sulfotransferase family cytosolic 1C member 2, SULT1C#1, SULT1C1, SULT1C2....

H-Cys(Bzl)-OH

Reference: HY-W014329

€0.00 (tax incl.)

H-Cys(Bzl)-OH is a cysteine derivative.

Recombinant Human DCTN6

Reference: P4050

€0.00 (tax incl.)

Synonyms: DCTN6, DCTN6_HUMAN, Dynactin 6, Dynactin subunit 6, Dynactin subunit p27, Novel RGD containing protein, p27, Protein WS-3, Protein WS3, WS 3, WS3. Lyophilized from a 0.2um filtered solution in PBS with 5%...

TAT-NSF222 Fusion Peptide

Reference: HY-P4110

€0.00 (tax incl.)

TAT-NSF222 Fusion Peptide is a fusion polypeptide with two domains, a TAT domain, which enters cells through macropinocytosis, and an NSF domain that inhibits N-ethylmaleimide-sensitive factor (NSF). TAT-NSF222 Fusion...

Recombinant Human RTCD1

Reference: P4051

€0.00 (tax incl.)

Synonyms: 2310009A18Rik, AI450277, EC 6.5.1.4, MGC102342, MGC94866, RNA 3' terminal phosphate cyclase, RNA 3-prime-terminal phosphate cyclase, RNA cyclase, RNA terminal phosphate cyclase domain 1, RNA terminal...

Fmoc-Ala-Glu-Asn-Lys-NH2

Reference: HY-114174

€0.00 (tax incl.)

Fmoc-Ala-Glu-Asn-Lys-NH2 is a selective asparagine endopeptidase (AEP) inhibitor peptide and suppresses amyloid precursor protein (APP) cleavage. AEP, a pH-controlled cysteine proteinase, is activated during ageing...

Recombinant Human Synaptotagmin V

Reference: P4052

€0.00 (tax incl.)

Synonyms: Synaptotagmin 5, Synaptotagmin IX, Synaptotagmin V, Synaptotagmin-5, Syt5, SYT5_HUMAN, SytV. Lyophilized from a 0.2um filtered solution in PBS with 5% trehalose, pH7.4

VSGLNPSLWSIFGLQFILLWLVSGSRHYLW

Reference: HY-P3431

€0.00 (tax incl.)

VSGLNPSLWSIFGLQFILLWLVSGSRHYLW is a 30-amino-acid peptide mimicking the C-terminal domain of α2δ-1, termed as α2δ-1Tat peptide. VSGLNPSLWSIFGLQFILLWLVSGSRHYLW can effectively interrupt the α2δ-1 - NMDAR interaction in...

Recombinant Human BIN1

Reference: P4053

€0.00 (tax incl.)

Synonyms: AMPH 2, AMPH2, Amphiphysin 2, Amphiphysin II, Amphiphysin like protein, amphiphysin-like, Amphiphysin-like protein, AMPHL, Bin1, BIN1_HUMAN, Box Dependant MYC Interacting Protein 1, Box-dependent...

Fmoc-Ser(tBu)-Thr(psi(Me,Me)pro)-OH

Reference: HY-P2394

€0.00 (tax incl.)

Fmoc-Ser(tBu)-Thr(psi(Me,Me)pro)-OH is a dipeptide.

Recombinant Human KRIT1

Reference: P4054

€0.00 (tax incl.)

Synonyms: Ankyrin repeat containing protein Krit1, CAM, CCM 1, CCM1, Cerebral cavernous malformations 1, Cerebral cavernous malformations 1 protein, Krev interaction trapped 1, Krev interaction trapped protein 1, KRIT...

NH2-c[X-R-L-S-X]-K-G-P-(D-2Nal)

Reference: HY-P3347

€0.00 (tax incl.)

NH2-c[X-R-L-S-X]-K-G-P-(D-2Nal) (compound 40), a macrocyclic analogue of Ape13, is a potent APJ agonist (Ki=5.7 nM). NH2-c[X-R-L-S-X]-K-G-P-(D-2Nal) exhibits a favorable Gα12-biased signaling and an increased in vivo...

Recombinant Human Syntenin

Reference: P4055

€0.00 (tax incl.)

Synonyms: MDA-9, MDA9, Melanoma differentiation-associated protein 9, Pro-TGF-alpha cytoplasmic domain-interacting protein 18, Scaffold protein Pbp1, SDCB1_HUMAN, SDCBP, ST1, SYCL, Syndecan binding protein (syntenin),...

Amylin (IAPP), feline

Reference: HY-P1871

€0.00 (tax incl.)

Amylin (IAPP), feline is a 37-amino acid polypeptide from feline. Amylin (IAPP), feline is one of the major secretory products of β-cells of the pancreatic islets. Amylin (IAPP), feline is a regulatory peptide, which...

Recombinant Human CCL21

Reference: P4056

€0.00 (tax incl.)

Synonyms: 6Ckine, Beta chemokine exodus 2, Beta-chemokine exodus-2, C C motif chemokine ligand 21, C-C motif chemokine 21, CCL21, CCL21_HUMAN, Chemokine (C-C motif) ligand 21, Chemokine CC motif ligand 21, CKb9, ECL,...

Disitertide TFA

Reference: HY-P0118A

€0.00 (tax incl.)

Disitertide (P144) TFA is a peptidic transforming growth factor-beta 1 (TGF-β1) inhibitor specifically designed to block the interaction with its receptor. Disitertide TFA is also a PI3K inhibitor and an apoptosis...

Recombinant Human CYR61

Reference: P4057

€0.00 (tax incl.)

Synonyms: 3CH61, CCN 1, CCN family member 1, CCN1, CYR 61, Cyr61, CYR61 protein, CYR61_HUMAN, Cysteine rich angiogenic inducer 61, Cysteine rich heparin binding protein 61, Cysteine-rich angiogenic inducer 61, GIG 1,...

AMY-101

Reference: HY-P1717

€0.00 (tax incl.)

AMY-101 (Cp40), a peptidic inhibitor of the central complement component C3 (KD = 0.5 nM), inhibits naturally occurring periodontitis in non-human primates (NHPs). AMY-101 (Cp40) exhibits a favorable anti-inflammatory...

Recombinant Human Pirin

Reference: P4058

€0.00 (tax incl.)

Synonyms: 3-dioxygenase PIR, Iron binding nuclear protein, Pir, PIR_HUMAN, Pirin, Probable quercetin 2, probable quercetin 2,3-dioxygenase PIR, Probable quercetinase. Lyophilized from a 0.2um filtered solution in PBS...

Dalazatide TFA

Reference: HY-P3507A

€0.00 (tax incl.)

Dalazatide (ShK-186) TFA is a specific Kv1.3 potassium channel peptide inhibitor. Dalazatide TFA can be used in the study of autoimmune diseases such as multiple sclerosis (MS), lupus erythematosus, psoriasis,...

Recombinant Human MDC

Reference: P4059

€0.00 (tax incl.)

Synonyms: A 152E5.1, ABCD 1, ABCD1, C C motif chemokine 22, CC chemokine STCP 1, CC chemokine STCP-1, ccl 22, Ccl22, CCL22_HUMAN, Chemokine (C C motif) ligand 22, DC/B CK, DCBCK, Macrophage-derived chemokine, MDC,...

Pinealon

Reference: HY-P4052

€0.00 (tax incl.)

Pinealon is a 3-amino acid peptide and shows neuroprotective properties. Pinealon prevents reactive oxygenspecies (ROS) accumulation and supressesthe activation of ERK 1/2. Pinealon has the ability to stimulate the...

Recombinant Human NME4

Reference: P4060

€0.00 (tax incl.)

Synonyms: metastatic inhibition factor NM23H4, mitochondrial, NDK, NDKM_HUMAN, NDP kinase, NDP kinase D, NDP kinase, mitochondrial, NDPK D, NDPKD, nm23 H4, nm23-H4, NM23D, NM23H4, Nm23M4, NME/NM23 nucleoside...

AC 187

Reference: HY-P1393

€0.00 (tax incl.)

AC 187 is a potent and orally active amylin receptor antagonist with an IC50 of 0.48 nM and a Ki of 0.275 nM. AC 187 shows more selective for amylin receptor than calcitonin and CGRP receptors. AC 187 has...

Recombinant Human FBP2

Reference: P4061

€0.00 (tax incl.)

Synonyms: 6-bisphosphatase isozyme 2, 6-bisphosphate 1-phosphohydrolase 2, D fructose 1 6 bisphosphate 1 phosphohydrolase 2, D-fructose-1, F16P2_HUMAN, FBP 2, fbp2, FBPase, FBPase 2, fructose 1 6 bisphosphatase 2,...

Contulakin G

Reference: HY-P0066

€0.00 (tax incl.)

Contulakin G is an O-glycosylated invertebrate neurotensin. Contulakin-G is a weaker agonist for the neurotensin receptor. Contulakin G is also a potent antinociceptive agent.

Recombinant Human UBE2C

Reference: P4062

€0.00 (tax incl.)

Synonyms: Cyclin selective ubiquitin carrier protein, dJ447F3.2, Mitotic specific ubiquitin conjugating enzyme, UB E2C, UBCH 10, UbcH10, UBE 2C, Ube2c, UBE2C_HUMAN, Ubiquitin carrier protein C, Ubiquitin carrier...

Lecirelin

Reference: HY-P0051

€0.00 (tax incl.)

Lecirelin, a synthetic gonadotropin-releasing hormone (GnRH) analogue, acts as a GnRH agonist. Lecirelin is widely used for the research of bovine ovarian follicular cysts.

Recombinant Human PDXK.1

Reference: P4063

€0.00 (tax incl.)

Synonyms: pdxK, PDXK_HUMAN, PKH, PNK, Pyridoxal kinase, Pyridoxamine kinase, Pyridoxine kinase, Pyridoxine kinase;, Vitamin B6 kinase. Lyophilized from a 0.2um filtered solution in PBS with 5% trehalose, pH7.4

Ac-Nle-Pro-Nle-Asp-AMC

Reference: HY-P2016

€0.00 (tax incl.)

Ac-Nle-Pro-Nle-Asp-AMC is a specific substrate for 26S proteasome. Ac-Nle-Pro-Nle-Asp-AMC can be used for the 26S proteasome caspase-like activity analysis.

Recombinant Mouse Peroxiredoxin 6

Reference: P4064

€0.00 (tax incl.)

Synonyms: 1 Cys, 1 Cys peroxiredoxin, 1 Cys PRX, 1 cysPrx, 1-Cys peroxiredoxin, 1-Cys PRX, 24 kDa protein, 9430088D19Rik, AA690119, Acidic calcium independent phospholipase A2, Acidic calcium-independent phospholipase...

(S)-(+)-2-Phenylglycine methyl ester hydrochloride

Reference: HY-W019714

€0.00 (tax incl.)

(S)-(+)-2-Phenylglycine methyl ester hydrochloride is a Glycine (HY-Y0966) derivative.

Recombinant Mouse Ogg1

Reference: P4065

€0.00 (tax incl.)

Synonyms: 8 hydroxyguanine DNA glycosylase, 8 oxoguanine DNA glycosylase, 8 oxoguanine DNA glycosylase 1, AP lyase, DNA (apurinic or apyrimidinic site) lyase, DNA apurinic or apyrimidinic site lyase, DNA lyase,...

N-Formyl-Met-Leu-Phe-Lys

Reference: HY-P1744

€0.00 (tax incl.)

N-Formyl-Met-Leu-Phe-Lys (fMLFK) is a peptide, acts as a potent and selective agonist of FPR1, with EC50s of 3.5 nM, 6.7 μM and 0.88 μM for FPR1, FPR2 and FPR2-D2817.32G, respectively.

Recombinant Human ISLR

Reference: P4066

€0.00 (tax incl.)

Synonyms: AW553146, HsT17563, Immunoglobulin superfamily containing leucine-rich repeat protein, Islr, ISLR_HUMAN, MGC102816, OTTHUMP00000174967, OTTHUMP00000174968, UNQ189/PRO215. Lyophilized from a 0.2um filtered...

TfR-T12

Reference: HY-P2297

€0.00 (tax incl.)

TfR-T12 is a BBB-penetrated transferrin receptor (TfR) binding peptide, displaying a binding affinity in the nM range.

Recombinant Human CDKA1

Reference: P4067

€0.00 (tax incl.)

Synonyms: CDK2 A1, CDK2 associated protein 1, CDK2-associated protein 1, CDK2AP1, CDKA1, CDKA1_HUMAN, Cyclin dependent kinase 2 associated protein 1, Cyclin-dependent kinase 2-associated protein 1, Deleted in oral...

Influenza NP (147-155)

Reference: HY-P1762

€0.00 (tax incl.)

Influenza NP (147-155) is a Kd restricted epitope from influenza nucleoprotein.

Recombinant Human COPE

Reference: P4068

€0.00 (tax incl.)

Synonyms: 1110005D17Rik, Coatomer epsilon subunit, Coatomer protein complex subunit epsilon, Coatomer subunit epsilon, COPE, COPE_HUMAN, Cope1, Epsilon coat protein, Epsilon COP, Epsilon COP I, Epsilon subunit of...

Eptifibatide monoacetate

Reference: HY-B0686A

€0.00 (tax incl.)

Eptifibatide monoacetate is a cyclic heptapeptide, acts as a competitive antagonist for the activated platelet glycoprotein IIb/IIIa receptor, with anti-platelet activity.

Recombinant Human RFXANK

Reference: P4069

€0.00 (tax incl.)

Synonyms: ANKRA1, Ankyrin repeat containing regulatory factor X associated protein, Ankyrin repeat family A protein 1, BLS, DNA-binding protein RFXANK, F14150_1, MGC138628, Regulatory factor X associated ankyrin...

NLS-StAx-h

Reference: HY-P2272

€0.00 (tax incl.)

NLS-StAx-h is a selective, cell permeable, stapled peptide Wnt signaling inhibitor with an IC50 of 1.4 μM. NLS-StAx-h efficiently inhibits β-catenin-transcription factor interactions. NLS-StAx-h shows...

Recombinant Human EIF1AY

Reference: P4070

€0.00 (tax incl.)

Synonyms: eIF 1A Y isoform, eIF 4C, eIF-1A Y isoform, EIF-4C, EIF1AY, Eukaryotic translation initiation factor 1A, Eukaryotic translation initiation factor 1A, Y chromosomal, Eukaryotic translation initiation factor...

740 Y-P TFA

Reference: HY-P0175A

€0.00 (tax incl.)

740 Y-P TFA is a potent and cell-permeable PI3K activator. 740 Y-P TFA readily binds GST fusion proteins containing both the N- and C- terminal SH2 domains of p85 but fails to bind GST alone.

Recombinant Human Superoxide Dismutase 4

Reference: P4071

€0.00 (tax incl.)

Synonyms: CCS, CCS_HUMAN, Copper chaperone for superoxide dismutase, MGC138260, SOD 4, SOD4, Superoxide dismutase copper chaperone. Lyophilized from a 0.2um filtered solution in PBS with 5% trehalose, pH7.4

HAEGTFT

Reference: HY-P1228

€0.00 (tax incl.)

HAEGTFT is the first N-terminal 1-7 residues of GLP-1 peptide.

Recombinant Human CXCL11

Reference: P4072

€0.00 (tax incl.)

Synonyms: b R1, b-R1, Beta-R1, betaR1, C-X-C motif chemokine 11, Chemokine (C-X-C motif) ligand 11, Chemokine C-X-C motif ligand 11, CXC11, CXCL11, CXL11_HUMAN, H174, I TAC, I-TAC, Interferon gamma inducible protein...

Fmoc-D-Asp(OtBu)-OH

Reference: HY-W013144

€0.00 (tax incl.)

Fmoc-D-Asp(OtBu)-OH is an aspartic acid derivative.

Recombinant Human DNALI1

Reference: P4073

€0.00 (tax incl.)

Synonyms: axonemal, Axonemal dynein light chain, Axonemal dynein light chain (hp28), Axonemal dynein light intermediate polypeptide 1, dJ423B22.5, DNALI 1, DNALI1, Dynein axonemal light intermediate chain 1, Dynein...

DX600 TFA

Reference: HY-P2222

€0.00 (tax incl.)

DX600 TFA is an ACE2 specific inhibitor, and do not cross-react with ACE.

Recombinant Human CHD2

Reference: P4074

€0.00 (tax incl.)

Synonyms: 2810013C04Rik, 2810040A01Rik, 5630401D06Rik, AI851092, ATP dependent helicase CHD2, ATP-dependent helicase CHD2, BC029703, CHD 2, CHD-2, CHD2, CHD2_HUMAN, chromodomain helicase dna binding protein,...

CGGRGD

Reference: HY-P2219

€0.00 (tax incl.)

CGGRGD, a RGD derivative with cysteine as its N-terminal, CGGRGD is synthesized via solid-phase peptide synthesis technique and the surface of PCL fibers is aminolysised by amino 2-cyanobenzothiazole followed by the...

Recombinant Human Torsin A

Reference: P4075

€0.00 (tax incl.)

Synonyms: DQ2, Dystonia 1, Dystonia 1 protein, Dystonia 1 torsion, Dyt1, TOR1A, TOR1A_HUMAN, Torsin 1A, Torsin A, Torsin family 1 member A, Torsin family 1, member A (torsin A), Torsin-1A. Lyophilized from a 0.2um...

ErbB-2-binding peptide

Reference: HY-P4082

€0.00 (tax incl.)

ErbB-2-binding peptide (HER2-binding peptide) is a tumor-binding peptide. ErbB-2-binding peptide has the potential for cancer research.

Recombinant Human IMPA2

Reference: P4076

€0.00 (tax incl.)

Synonyms: IMP 2, IMP A2, IMP.18P, IMP2, IMPA 2, Impa2, IMPA2_HUMAN, IMPase 2, Inosine monophosphatase 2, Inositol 1, Inositol 1(or 4) monophosphatase 2, Inositol monophosphatase 2, Inositol monophosphatase 2 variant...

Human PD-L1 inhibitor III

Reference: HY-P2564

€0.00 (tax incl.)

Human PD-L1 inhibitor III is a human PD-L1 inhibitor.

Recombinant Human Acyl-coenzyme A Thioesterase 8

Reference: P4077

€0.00 (tax incl.)

Synonyms: ACTEIII, Acot8, ACOT8_HUMAN, Acyl CoA thioesterase 8, Acyl-CoA thioesterase 8, Acyl-coenzyme A thioesterase 8, Choloyl coenzyme A thioesterase, Choloyl-coenzyme A thioesterase, hACTE III, hACTE-III,...

Atosiban acetate

Reference: HY-17572A

€0.00 (tax incl.)

Atosiban acetate (RW22164 acetate;RWJ22164 acetate) is a nonapeptide competitive vasopressin/oxytocin receptor antagonist, and is a desamino-oxytocin analogue. Atosiban is the main tocolytic agent and has the...

Recombinant Human PDCD5

Reference: P4078

€0.00 (tax incl.)

Synonyms: PDCD5, PDCD5_HUMAN, Programmed cell death protein 5, Protein TFAR19, TF 1 cell apoptosis related protein 19, TF-1 cell apoptosis-related protein 19, TFAR19, TFAR19 novel apoptosis-related. Lyophilized from a...

K-(D-1-Nal)-FwLL-NH2 TFA

Reference: HY-P1432A

€0.00 (tax incl.)

K-(D-1-Nal)-FwLL-NH2 TFA is a high affinity and potent ghrelin receptor inverse agonist (Ki values are 4.9 and 31 nM in COS7 and HEK293T cells, respectively). K-(D-1-Nal)-FwLL-NH2 blocks ghrelin receptor-mediated Gq-...

Recombinant Human PDCD5

Reference: P4079

€0.00 (tax incl.)

Synonyms: PDCD5, PDCD5_HUMAN, Programmed cell death protein 5, Protein TFAR19, TF 1 cell apoptosis related protein 19, TF-1 cell apoptosis-related protein 19, TFAR19, TFAR19 novel apoptosis-related. Lyophilized from a...

Pasireotide pamoate

Reference: HY-108768

€0.00 (tax incl.)

Pasireotide (SOM230) pamoate, a long-acting cyclohexapeptide somatostatin analogue, can improve agonist activity at somatostatin receptors (subtypes sst1/2/3/4/5, pKi=8.2/9.0/9.1/

Recombinant Human DR5

Reference: P4080

€0.00 (tax incl.)

Synonyms: Fas like protein, Apoptosis inducing protein TRICK2A/2B, Apoptosis inducing receptor TRAIL R2, CD262, CD262 antigen, Cytotoxic TRAIL receptor 2, Death domain containing receptor for TRAIL/Apo 2L, Death...

Ziconotide TFA

Reference: HY-P0062A

€0.00 (tax incl.)

Ziconotide TFA (SNX-111 TFA), a peptide, is a potent and selective block of N-type calcium channels antagonist. Ziconotide TFA reduces synaptic transmission, and can be used for chronic pain research.

Recombinant Human RANKL

Reference: P4081

€0.00 (tax incl.)

Synonyms: CD254, hRANKL2, ODF, OPGL, OPTB2, Osteoclast differentiation factor, Osteoprotegerin ligand, RANKL, Receptor activator of nuclear factor kappa B ligand, Receptor activator of nuclear factor kappa-B ligand,...

N-Acetyl-DL-serine

Reference: HY-W142092

€0.00 (tax incl.)

N-Acetyl-DL-serine is a hydrophobic amino acid that is synthesized in the body and can be found as a free form or as a salt with malonate, phosphate, or acetate. N-Acetyl-DL-serine has antimicrobial activity against...

Recombinant Human HS3ST1

Reference: P4082

€0.00 (tax incl.)

Synonyms: 3-OST-1, 3OST, 3OST1, EC 2.8.2.23, h3 OST 1, h3-OST-1, Heparan sulfate (glucosamine) 3 O sulfotransferase 1, Heparan sulfate 3 O sulfotransferase 1, Heparan sulfate 3-O-sulfotransferase 1, Heparan sulfate D...

Gly-Phe-Arg

Reference: HY-P0296

€0.00 (tax incl.)

Gly-Phe-Arg is a superpotent synthetic tripeptide mimics of the mud-crab pumping pheromone.

Recombinant Human GDF8

Reference: P4083

€0.00 (tax incl.)

Synonyms: GDF 8, GDF-8, GDF8, GDF8_HUMAN, Growth differentiation factor 8, Growth/differentiation factor 8, MSLHP, MSTN, Myostatin, OTTHUMP00000163498. Lyophilized from a 0.2um filtered solution in PBS with 5%...

Lauryl-LF 11

Reference: HY-P1062

€0.00 (tax incl.)

Lauryl-LF 11, N-terminally acylated analogue of LF11, is a peptide with antibacterial activity.

Recombinant Human MRas

Reference: P4085

€0.00 (tax incl.)

Synonyms: FLJ42964, M ras, M-ras, Mras, Muscle and microspikes Ras, Muscle RAS oncogene homolog, Muscle Ras oncogene homologue, Muscle Ras viral oncogene homolog, R ras3, R-ras3, Ras related protein MRas, Ras related...

Nonapeptide-1

Reference: HY-P0097

€0.00 (tax incl.)

Nonapeptide-1 (Melanostatine-5), a peptide hormone, is a selective antagonist of MC1R (Ki: 40 nM). Nonapeptide-1 is a competitive α-MSH antagonist that potently inhibits intracellular cAMP and melanosome dispersion...

Recombinant Human PSMA7

Reference: P4086

€0.00 (tax incl.)

Synonyms: C6, HSPC, MGC3755, OTTHUMP00000031449, OTTHUMP00000031450, OTTHUMP00000031453, Proteasome (prosome macropain) subunit alpha type 7, Proteasome alpha 7 subunit, Proteasome subunit alpha 4, Proteasome subunit...

Acetyl-(D-Arg2)-GRF (1-29) amide (human)

Reference: HY-P4750

€0.00 (tax incl.)

Acetyl-(D-Arg2)-GRF (1-29) amide (human) is an antagonist of growth hormone releasing factor (GRF). Acetyl-(D-Arg2)-GRF (1-29) amide (human) inhibits the release of growth hormone (GH) and can be used for endocrine...

Recombinant Human TACI

Reference: P4087

€0.00 (tax incl.)

Synonyms: CD 267, CD267, CD267 antigen, CVID, CVID2, FLJ39942, MGC133214, MGC39952, OTTHUMP00000065442, TNFRSF 13B, TNFRSF 14B, TNFRSF13B, TNFRSF13B protein, TNFRSF14B, TR13B_HUMAN, Transmembrane activator and CAML...

Category: Proteins & Peptides

Menu

Settings