Prolactin-Releasing Peptide (1-31), bovine Reference: HY-P3946 Prolactin-Releasing Peptide (1-31), bovine is a fragment of the prolactin releasing peptide (PrRP).
Human DCTN2 protein, His tag Reference: GTX68171-pro This gene encodes a 5-kD subunit of dynactin, a macromolecular complex consisting of 1-11 subunits ranging in size from 22 to 15 kD. Dynactin binds to both microtubules and cytoplasmic dynein. It is involved in a diverse array of cellular functions, including ER-to-Golgi transport, the centripetal movement of lysosomes and endosomes, spindle formation, chromosome movement, nuclear positioning, and axonogenesis. This subunit is present in 4-5 copies per dynactin molecule. It contains three short alpha-helical coiled-coil domains that may mediate association with self or other dynactin subunits. It may interact directly with the largest subunit (p15) of dynactin and may affix p15 in place. Multiple alternatively spliced transcript variants encoding distinct isoforms have been found for this gene. [provided by RefSeq, May 212]
DPDPE Reference: HY-P1334 DPDPE, an opioid peptide, is a selective δ-opioid receptor (DOR) agonist with anticonvulsant effects.
Human DCTN2 protein, His tag Reference: GTX68172-pro This gene encodes a 5-kD subunit of dynactin, a macromolecular complex consisting of 1-11 subunits ranging in size from 22 to 15 kD. Dynactin binds to both microtubules and cytoplasmic dynein. It is involved in a diverse array of cellular functions, including ER-to-Golgi transport, the centripetal movement of lysosomes and endosomes, spindle formation, chromosome movement, nuclear positioning, and axonogenesis. This subunit is present in 4-5 copies per dynactin molecule. It contains three short alpha-helical coiled-coil domains that may mediate association with self or other dynactin subunits. It may interact directly with the largest subunit (p15) of dynactin and may affix p15 in place. Multiple alternatively spliced transcript variants encoding distinct isoforms have been found for this gene. [provided by RefSeq, May 212]
Galanin Receptor Ligand M35 TFA Reference: HY-P1840A Galanin Receptor Ligand M35 TFA is a high-affinity ligand and antagonist of galanin receptor (Kd=0.1 nM). Galanin Receptor Ligand M35 TFA exerts a Ki values of 0.11 and 2.0 nM for human galanin receptor type 1 and 2, respectively.
Human HBXIP protein, His tag Reference: GTX68173-pro This gene encodes a protein that specifically complexes with the C-terminus of hepatitis B virus X protein (HBx). The function of this protein is to negatively regulate HBx activity and thus to alter the replication life cycle of the virus. [provided by RefSeq, Jul 28]
SV40 T-Ag-derived NLS peptide Reference: HY-P1877 SV40 T-Ag-derived NLS peptide is a nuclear localization signal DNA tagged to this peptide efficiently translocates into the cell nucleus.
VSGLNPSLWSIFGLQFILLWLVSGSRHYLW TFA Reference: HY-P3431A VSGLNPSLWSIFGLQFILLWLVSGSRHYLW (TFA) is a 30-amino-acid peptide mimicking the C-terminal domain of α2δ-1, termed as α2δ-1Tat peptide. VSGLNPSLWSIFGLQFILLWLVSGSRHYLW can effectively interrupt the α2δ-1 - NMDAR interaction in vitro and in vivo. VSGLNPSLWSIFGLQFILLWLVSGSRHYLW can be used for researching neuropathic pain.
Human SIVA protein, His tag Reference: GTX68176-pro This gene encodes an E3 ubiquitin ligase that regulates cell cycle progression, cell proliferation and apoptosis. The N-terminus of this protein binds to the cytoplasmic tail of the CD27 antigen, a member of the tumor necrosis factor receptor (TNFR) superfamily. In response to UV radiation-induced DNA damage, this protein has been shown to mediate the ubiquitination of proliferating cell nuclear antigen (PCNA), an important step in translesion DNA synthesis. [provided by RefSeq, Sep 218]