Lactalbumin B (50-53) Alpha [Lactorphin Alpha], bovine Reference: HY-P3976 Lactalbumin B (50-53) Alpha [Lactorphin Alpha], bovine is a blood pressure lowering peptide containing 4 amino acids. Lactalbumin B (50-53) Alpha [Lactorphin Alpha], bovine is an angiotensin-converting Enzyme (ACE) inhibitor. Lactalbumin B (50-53) Alpha [Lactorphin Alpha], bovine can be used in research of high blood pressure.
Human SET protein, His tag Reference: GTX67811-pro The protein encoded by this gene inhibits acetylation of nucleosomes, especially histone H4, by histone acetylases (HAT). This inhibition is most likely accomplished by masking histone lysines from being acetylated, and the consequence is to silence HAT-dependent transcription. The encoded protein is part of a complex localized to the endoplasmic reticulum but is found in the nucleus and inhibits apoptosis following attack by cytotoxic T lymphocytes. This protein can also enhance DNA replication of the adenovirus genome. Several transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Oct 211]
Ederimotide Reference: HY-P3058 Ederimotide(WT-1 A1) can be used as a potential target for studying pancreatic cancer.
Human SF2 protein, His tag Reference: GTX67812-pro This gene encodes a member of the arginine/serine-rich splicing factor protein family. The encoded protein can either activate or repress splicing, depending on its phosphorylation state and its interaction partners. Multiple transcript variants have been found for this gene. There is a pseudogene of this gene on chromosome 13. [provided by RefSeq, Jun 214]
STIEEQAKTFLDKFNHEAEDLFYQSSLASWN Reference: HY-P3141 STIEEQAKTFLDKFNHEAEDLFYQSSLASWN, an angiotensin-converting enzyme 2 (ACE2) related peptide, can be used to study the function of ACE2.
Human SF2 protein, His tag Reference: GTX67813-pro This gene encodes a member of the arginine/serine-rich splicing factor protein family. The encoded protein can either activate or repress splicing, depending on its phosphorylation state and its interaction partners. Multiple transcript variants have been found for this gene. There is a pseudogene of this gene on chromosome 13. [provided by RefSeq, Jun 214]
Vosoritide acetate Reference: HY-P3503A Vosoritide (BMN 111) acetate is a natriuretic peptide receptor 2 (NPR2) agonist that acts on the proliferation and differentiation of chondrocytes to promote bone growth.
Human SGTA protein, His tag Reference: GTX67814-pro This gene encodes a protein which is capable of interacting with the major nonstructural protein of parvovirus H-1 and 7-kDa heat shock cognate protein; however, its function is not known. Since this transcript is expressed ubiquitously in various tissues, this protein may serve a housekeeping function. [provided by RefSeq, Jul 28]
Thioredoxin reductase peptide TFA Reference: HY-P1948A Thioredoxin reductase peptide TFA corresponds to residues 53–67 in thioredoxin reductase (TrxR), used in thioredoxin reductase research. Thioredoxin reductase acts as a reductant of disulfide-containing proteins and plays crucial role in cellular antioxidant defense.