AH1 Reference: HY-P4193 AH1 is an immunodominant antigen derived from the gp70 product of an endogenous MuLV. AH1 behaves as the CTL-immunodominant epitope of CT26 colon carcinoma.
Human Oct4 protein, His tag Reference: GTX67656-pro This gene encodes a transcription factor containing a POU homeodomain that plays a key role in embryonic development and stem cell pluripotency. Aberrant expression of this gene in adult tissues is associated with tumorigenesis. This gene can participate in a translocation with the Ewings sarcoma gene on chromosome 21, which also leads to tumor formation. Alternative splicing, as well as usage of alternative AUG and non-AUG translation initiation codons, results in multiple isoforms. One of the AUG start codons is polymorphic in human populations. Related pseudogenes have been identified on chromosomes 1, 3, 8, 1, and 12. [provided by RefSeq, Oct 213]
FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS Reference: HY-P1229 FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is an Exendin-4 peptide derivative.
Bim BH3, Peptide IV TFA Reference: HY-P1889A Bim BH3, Peptide IV TFA is a 26-residue peptide from BH3-only protein Bim, which belongs to the pro-apoptotic group of the Bcl-2 family of proteins.
Human PPA1 protein, His tag Reference: GTX67658-pro The protein encoded by this gene is a member of the inorganic pyrophosphatase (PPase) family. PPases catalyze the hydrolysis of pyrophosphate to inorganic phosphate, which is important for the phosphate metabolism of cells. Studies of a similar protein in bovine suggested a cytoplasmic localization of this enzyme. [provided by RefSeq, Jul 28]
Atrial Natriuretic Peptide (1-28), human, porcine, Biotin-labeled Reference: HY-P2491 Atrial Natriuretic Peptide (1-28), human, porcine, Biotin-labeled, one of three mammalian natriuretic peptides (NPs), has endocrine effects on fluid homeostasis and blood pressure. Atrial Natriuretic Peptide has the potential for cardiovascular diseases research.
Human PPM1G protein, His tag Reference: GTX67659-pro The protein encoded by this gene is a member of the PP2C family of Ser/Thr protein phosphatases. PP2C family members are known to be negative regulators of cell stress response pathways. This phosphatase is found to be responsible for the dephosphorylation of Pre-mRNA splicing factors, which is important for the formation of functional spliceosome. Studies of a similar gene in mice suggested a role of this phosphatase in regulating cell cycle progression. [provided by RefSeq, Apr 21]
Fmoc-N(Me)-Sar10 Reference: HY-P4198 Fmoc-N(Me)-Sar10 can be used for synthesis of peptide ligand-agent conjugates.
Human PP1C gamma protein, His tag Reference: GTX67660-pro The protein encoded by this gene belongs to the protein phosphatase family, PP1 subfamily. PP1 is an ubiquitous serine/threonine phosphatase that regulates many cellular processes, including cell division. It is expressed in mammalian cells as three closely related isoforms, alpha, beta/delta and gamma, which have distinct localization patterns. This gene encodes the gamma isozyme. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Oct 211]