Category: Peptides

Filter By
Brand: Agrisera Brand: ApexBio Brand: Histosure Brand: Signalchem Clear all
Histone H1 Peptide Histone H1 Peptide

Histone H1 Peptide

Reference: H10-58-1
€0.00 (tax incl.)
The Histone H1 Peptide (152-159) sequence (GGGPATP-KKAKKL-COOH) is derived from human histone H1 between amino acids 152-159 and is suitable for use as the substrate for CDK family kinase assays, such as CDK1, CDK2,...
Histone H3 Peptide (1-21) Histone H3 Peptide (1-21)

Histone H3 Peptide (1-21)

Reference: H12-58-500
€0.00 (tax incl.)
The Histone H3 Peptide (1-21) sequence (ARTKQTARKS-TGGKAPRKQLAGGKKC) is derived from human histone H3 (1-21) and is suitable for use as the substrate for histone methyltransferase (at K4 and K9) and acetyltransferase...
Histone H3 Peptide (1-21) Histone H3 Peptide (1-21)

Histone H3 Peptide (1-21)

Reference: H12-58-01
€0.00 (tax incl.)
The Histone H3 Peptide (1-21) sequence (ARTKQTARKS-TGGKAPRKQLAGGKKC) is derived from human histone H3 (1-21) and is suitable for use as the substrate for histone methyltransferase (at K4 and K9) and acetyltransferase...
Histone H4 Peptide (1-21) Histone H4 Peptide (1-21)

Histone H4 Peptide (1-21)

Reference: H13-58-500
€0.00 (tax incl.)
The Histone H4 Peptide (1-21) sequence (SGRGKGGKGL-GKGGAKRHRKVGGKKC) is derived from human histone H4 (1-21) and is suitable for use as the substrate for histone methyltransferase (at R3) and acetyltransferase (at K5,...
Histone H4 Peptide (1-21) Histone H4 Peptide (1-21)

Histone H4 Peptide (1-21)

Reference: H13-58-01
€0.00 (tax incl.)
The Histone H4 Peptide (1-21) sequence (SGRGKGGKGL-GKGGAKRHRKVGGKKC) is derived from human histone H4 (1-21) and is suitable for use as the substrate for histone methyltransferase (at R3) and acetyltransferase (at K5,...
HSP27tide HSP27tide

HSP27tide

Reference: H31-58
€0.00 (tax incl.)
The HSP27tide peptide sequence (RRLNRQLSVA-amide) is based on the mouse HSP27 (amino acid 80-85).
IGF1Rtide IGF1Rtide

IGF1Rtide

Reference: I15-58
€0.00 (tax incl.)
The 14 amino acids of IGF1Rtide peptide sequence (KKKSPGEYVNIEFG) is derived from human IRS-1 protein residues 891-902.
IKKtide IKKtide

IKKtide

Reference: I33-58
€0.00 (tax incl.)
The IKKtide peptide sequence (KKKKERLLDDRHDSG-LDSMKDEE) is derived from human IkBA (amino acids 21-41) and is suitable as a substrate for IKK alpha and IKK beta.
IRS1 (Y608) Peptide IRS1 (Y608) Peptide

IRS1 (Y608) Peptide

Reference: I40-58-1000
€0.00 (tax incl.)
The synthetic IRS1 (Y608) Peptide [KKHTDDGYMPMSPGVA] is derived from mouse insulin receptor substrate 1 (amino acids 603-616) and is suitable as substrate for JAK1 and JAK2.
JAK3tide JAK3tide

JAK3tide

Reference: J03-58-1000
€0.00 (tax incl.)
The JAK3tide synthetic peptide [GGEEEEYFELVKKKK] is routinely evaluated as a substrate for JAK3 and JAK2.
LKBtide LKBtide

LKBtide

Reference: L15-58
€0.00 (tax incl.)
The synthetic peptide LKBtide (LSNLYHQGKFLQTFCGSPLY-RRRC) is derived from human NUAK2 (amino acid 196-215) and can be phosphorylated by protein Serine/Threonine kinase 11 (STK11), also known as LKB1.
LRRKtide LRRKtide

LRRKtide

Reference: L10-58
€0.00 (tax incl.)
The LRRKtide peptide sequence (RLGRDKYKTLRQIRQ) is derived from human ezrin (amino acids 561-573), moesin (amino acids 539-553) and radixin (amino acids 558-570) and is suitable for use as a substrate for LRRK kinases.
MARCKS Peptide MARCKS Peptide

MARCKS Peptide

Reference: M02-58
€0.00 (tax incl.)
The synthetic peptide (KKRFSFKKSFKL) is derived from amino acid residues 154 –165 of protein myristoylated alanine-rich C-kinase substrate (MARCKS). This peptide is suitable for use as a substrate for PKC alpha, PKC...
Micro2 Peptide Micro2 Peptide

Micro2 Peptide

Reference: M08-58-1000
€0.00 (tax incl.)
The Micro2 Peptide sequence (KEEQSQITSQVTGQIGWR) is derived from human AP-2 complex subunit mu isoform b (amino acids 143-160) and is suitable as a substrate for AAK1, BMP2K, and GAK kinase assay.
MLC Peptide MLC Peptide

MLC Peptide

Reference: M09-58
€0.00 (tax incl.)
The MLC Peptide sequence (AKRPQRATSNVFS) represents the phosphate-accepting domain of human MYL9 (amino acids 12-23) and can be used as a substrate for PHKG1, PHKG2 and DAPK2.
Modified EIF2S Peptide Modified EIF2S Peptide

Modified EIF2S Peptide

Reference: E23-58B
€0.00 (tax incl.)
The Modified EIF2S Peptide sequence (Modified-CILLSELSRRRIR) is derived from human EIF2S1 (46-57) and is suitable for use as the substrate for EIF2AK kinase family and MNK1.
Modified PLKtide Modified PLKtide

Modified PLKtide

Reference: P41-58B
€0.00 (tax incl.)
The Modified PLKtide peptide sequence (Modified-CKKLGEDQAEEISDDLLEDSLSDEDE) is derived from the CDC25C protein sequence (182-204).
Modified SGKtide Modified SGKtide

Modified SGKtide

Reference: S08-58B
€0.00 (tax incl.)
The Modified SGKtide peptide sequence (Modified- CKKRNRRLSVA) contains serine protein kinase phosphorylation site and is evaluated as a substrate for SGK and NDR family kinases.
MRCL3 Peptide MRCL3 Peptide

MRCL3 Peptide

Reference: M56-58
€0.00 (tax incl.)
The synthetic substrate MRCL3 Peptide (KKRPQRATSN-VFAM-NH2) is derived from human myosin regulatory light chain MRCL3 (amino acid 11-24) and can be used for MLCK, MYLK2 and MYLK3 kinase assay.
PAKtide PAKtide

PAKtide

Reference: P08-58
€0.00 (tax incl.)
The 10 amino acids of PAKtide peptide (RRRLSFAEPG) contain a serine/threonine protein kinase phosphorylation site in a common seven-residue epitope (1, 2).
PDHKtide PDHKtide

PDHKtide

Reference: P57-58
€0.00 (tax incl.)
The synthetic peptide substrate PDHKtide (RRYHGHSMS-DPGVSYRTR) is derived from human PDHA1 protein (amino acid 288-304aa) and can be used for PDHK family kinase assay.
PDKtide PDKtide

PDKtide

Reference: P10-58
€0.00 (tax incl.)
The 39 amino acids of PDKtide peptide sequence ([protein fragment, 39 aa]) is derived from two human proteins: residues 1-14 are based on AKT1 (307-320) and residues 16-39 are based on PKN2/PRK2 (961-984).
PKCtide PKCtide

PKCtide

Reference: P15-58
€0.00 (tax incl.)
The PKCtide peptide sequence (ERMRPRKRQGSVRRRV) is based on protein kinase C epsilon (amino acid 149-164).
PLKtide PLKtide

PLKtide

Reference: P41-58
€0.00 (tax incl.)
The PLKtide peptide sequence (CKKLGEDQAEEISDDLLED-SLSDEDE) is derived from the CDC25C protein sequence (182-204).
Poly (4:1 Glu, Tyr) Peptide Poly (4:1 Glu, Tyr) Peptide

Poly (4:1 Glu, Tyr) Peptide

Reference: P61-58
€0.00 (tax incl.)
The Poly (4:1 Glu, Tyr) substrate peptide is used as universal substrate for protein tyrosine kinases.
PS7-CTD Peptide PS7-CTD Peptide

PS7-CTD Peptide

Reference: R06-58-
€0.00 (tax incl.)
The PS7-CTD peptide sequence (YSPTS PpSYSP TSPpS) is derived from C-terminal repeat domain of human RNA polymerase II.
RS Repeat Peptide RS Repeat Peptide

RS Repeat Peptide

Reference: R55-58
€0.00 (tax incl.)
The synthetic peptide (GRSRSRSRSRSRSRSR) contains serine/threonine protein kinase phosphorylation sites and is routinely evaluated as a substrate for CLK, EIF2AK and SRPK family kinases.
SAMStide SAMStide

SAMStide

Reference: S07-58
€0.00 (tax incl.)
The SAMStide peptide sequence (HMRSAMSGLHLVKRR) is based on the mouse acetyl-Coenzyme A carboxylase alpha (amino acid 73-85).
SGKtide SGKtide

SGKtide

Reference: S08-58
€0.00 (tax incl.)
The SGKtide peptide sequence (CKKRNRRLSVA) contains serine protein kinase phosphorylation site and is evaluated as a substrate for SGK and NDR family kinases.
TGFBR1 Peptide TGFBR1 Peptide

TGFBR1 Peptide

Reference: T36-58
€0.00 (tax incl.)
The TGFBR1 peptide sequence (KKKVLTQMGSPSIRC-S(pS)VS) is derived from human SMAD3 (215-230) and is suitable for use as the substrate for TGFBR1 superfamily, including ACVRs (ALK1, ALK2, ALK4 and ALK7) and BMPRs (ALK3...
Thr-phosphopeptide Thr-phosphopeptide

Thr-phosphopeptide

Reference: T69-58
€0.00 (tax incl.)
The Thr-phosphopeptide sequence (KRT(p)IRR) is derived from human NR2F6 (amino acids 79-84) and is suitable as a substrate for PP2A, PP2B, PP2C and PP1.
Thr-phosphopeptide-3 Thr-phosphopeptide-3

Thr-phosphopeptide-3

Reference: T72-58-01
€0.00 (tax incl.)
The Thr-phosphopeptide-3 sequence (RRAT(p)VA) is a phosphorylated threonyl derivative from human pyruvate kinase (amino acids 40-45) and is suitable as a substrate for PP1, PP2A, and PP2C (e.g. WIP1).
Tyr-phosphopeptide-2 Tyr-phosphopeptide-2

Tyr-phosphopeptide-2

Reference: T70-58
€0.00 (tax incl.)
The Tyr-phosphopeptide-2 sub peptide sequence (DADEY(p)LIPDQG) is based on mouse epidermal growth factor receptor isoform 1 (amino acid 1014-1024).
ULKtide ULKtide

ULKtide

Reference: U01-58-1
€0.00 (tax incl.)
The ULKtide synthetic peptide [YANWLAASIYLDGKKK] is routinely evaluated as a substrate for ULK family kinase assays.
ZIPtide ZIPtide

ZIPtide

Reference: Z16-58
€0.00 (tax incl.)
The ZIPtide substrate peptide sequence (KKLNRTLSFAEPG) is routinely evaluated as a substrate for DAPK3 (ZIPK).

Menu

Settings

Please sign in first.

Sign in