Filter By
        
    
	Filter By
	Category: Peptides
    Filter By
    
      
        
        
                  
        Reference: 10006591-1
      
      
    
    
    €0.00
            (tax incl.)
    
    
    
    
    
            
    
    
  
      
      
              
      Peptide Sequence:  CB1 receptor (C-Term) amino acids 461-472 · To be used in conjunction with Cayman’s CB1 Receptor (C-Term) polyclonal antibody (Item No. 10006590) to block protein-antibody complex formation during...
      
      
      Reference: 10006616-1
      
      
    
    
    €0.00
            (tax incl.)
    
    
    
    
    
            
    
    
  
      
      
              
      Peptide Sequence:  human S1P1 protein amino acids 241-253 (ISKASRSSEKSLA) · To be used in conjunction with Cayman’s S1P1 polyclonal antibody (Catalog No. 10005228) to block protein-antibody complex formation during...
      
      
      Reference: 10006618-1
      
      
    
    
    €0.00
            (tax incl.)
    
    
    
    
    
            
    
    
  
      
      
              
      Peptide Sequence: human 5-OxoETE receptor C-terminal amino acids 408-423 (KVQGEVSLEKEGSSQG) · To be used in conjunction with Cayman’s 5-OxoETE Receptor polyclonal antibody (Catalog No. 100025) to block...
      
      
      Reference: 10006620-1
      
      
    
    
    €0.00
            (tax incl.)
    
    
    
    
    
            
    
    
  
      
      
              
      Peptide Sequence:  human serine palmitoyltransferase subunit SPT2 amino acids 548-562 · To be used in conjunction with Cayman’s SPT polyclonal antibody (Catalog No. 10005260) to block protein-antibody complex...
      
      
      Reference: 10006790-1
      
      
    
    
    €0.00
            (tax incl.)
    
    
    
    
    
            
    
    
  
      
      
              
      Peptide Sequence:  murine amino acids 715-735 · To be used in conjunction with Cayman’s ChREBP polyclonal antibody (Catalog No. 10006789) to block protein-antibody complex formation during immunochemical analysis of...
      
      
      Reference: 10006823-1
      
      
    
    
    €0.00
            (tax incl.)
    
    
    
    
    
            
    
    
  
      
      
              
      Peptide Sequence:  human SPHK1 amino acids 264-274 (DLESEKYRRLG) · To be used in conjunction with Cayman’s Sphingosine Kinase 1 polyclonal antibody (Item No. 10006822) to block protein-antibody complex formation...
      
      
      Reference: 10006984-1
      
      
    
    
    €0.00
            (tax incl.)
    
    
    
    
    
            
    
    
  
      
      
              
      Peptide Sequence:  human LPA1 amino acids 342-359 · To be used in conjunction with Cayman’s LPA1 polyclonal antibody (Catalog No. 10005280) to block protein-antibody complex formation during immunochemical analysis of...
      
      
      Reference: 10007003-1
      
      
    
    
    €0.00
            (tax incl.)
    
    
    
    
    
            
    
    
  
      
      
              
      Peptide Sequence:  CRTH2/DP2 protein amino acids 378-395 · To be used in conjunction with Cayman’s CRTH2/DP2 Receptor (C-Term) polyclonal antibody (Catalog No. 10007002) to block protein-antibody complex formation...
      
      
      Reference: 10007073-1
      
      
    
    
    €0.00
            (tax incl.)
    
    
    
    
    
            
    
    
  
      
      
              
      Peptide Sequence:  human PTEN amino acids 254-270 · To be used in conjunction with Cayman’s PTEN polyclonal antibody (Catalog No. 10005059) to block protein-antibody complex formation during immunochemical analysis of...
      
      
      Reference: 10007186-1
      
      
    
    
    €0.00
            (tax incl.)
    
    
    
    
    
            
    
    
  
      
      
              
      Peptide Sequence:  human PCSK9 amino acids (SRSGKRRGERMEA) · To be used in conjunction with Cayman’s PCSK9 (human) polyclonal antibody (Catalog No. 10007185) to block protein-antibody complex formation during...
      
      
      Reference: 10007192-1
      
      
    
    
    €0.00
            (tax incl.)
    
    
    
    
    
            
    
    
  
      
      
              
      Peptide Sequence:  PH Domain Leucine-rich Repeat Protein Phosphatase (PHLPP) amino acids 1192-1205 (YQLDQLPDYYDTPL) · To be used in conjunction with Cayman’s PHLPP polyclonal antibody (Catalog No. 10007191) to block...
      
      
      Reference: 10007193-1
      
      
    
    
    €0.00
            (tax incl.)
    
    
    
    
    
            
    
    
  
      
      
              
      Peptide Sequence:  rat lysoPLD amino acids 573-588 · To be used in conjunction with Cayman’s lysoPLD polyclonal antibody (Catalog No. 10005375) to block protein-antibody complex formation during immunochemical...
      
      
      Reference: 10007206-1
      
      
    
    
    €0.00
            (tax incl.)
    
    
    
    
    
            
    
    
  
      
      
              
      Peptide Sequence:  human GPR40 amino acids 210-222 · To be used in conjunction with Cayman’s GPR40 polyclonal antibody (Catalog No. 10007605) to block protein-antibody complex formation during immunochemical analysis...
      
      
      Reference: 10007475-1
      
      
    
    
    €0.00
            (tax incl.)
    
    
    
    
    
            
    
    
  
      
      
              
      Peptide Sequence:  PEPCK protein amino acids 5-17 · To be used in conjunction with Cayman’s PEPCK polyclonal antibody (Catalog No. 10004943) to block protein-antibody complex formation during immunochemical analysis...
      
      
      Reference: 10007661-1
      
      
    
    
    €0.00
            (tax incl.)
    
    
    
    
    
            
    
    
  
      
      
              
      Peptide Sequence:  human GPR35 · To be used in conjunction with Cayman’s GPR35 polyclonal antibody (Catalog No. 10007660) to block protein-antibody complex formation during immunochemical analysis of GPR35.
      
      
      Reference: 10007672-1
      
      
    
    
    €0.00
            (tax incl.)
    
    
    
    
    
            
    
    
  
      
      
              
      To be used in conjunction with Cayman’s NPC1L1 Polyclonal Antibody (Item No. 100076655) to block protein-antibody complex formation during immunochemical analysis of NPC1L1
      
      
      Reference: 10007682-1
      
      
    
    
    €0.00
            (tax incl.)
    
    
    
    
    
            
    
    
  
      
      
              
      Peptide Sequence:  human amino acids 28-37 · To be used in conjunction with Cayman’s sRBP4 Polyclonal Antibody (Catalog No. 10007681) to block protein-antibody complex formation during immunochemical analysis of sRBP4.
      
      
      Reference: 10008206-1
      
      
    
    
    €0.00
            (tax incl.)
    
    
    
    
    
            
    
    
  
      
      
              
      Peptide Sequence:  human amino acids 192-206 · To be used in conjunction with Cayman’s IGFBP5 Polyclonal Antibody (Catalog No. 10008207) to block protein-antibody complex formation during immunochemical analysis of...
      
      
      Reference: 10008492-1
      
      
    
    
    €0.00
            (tax incl.)
    
    
    
    
    
            
    
    
  
      
      
              
      Peptide Sequence:  human ATGL protein amino acids 382-400 (KRKLGRHLPSRLPEQVELR) · To be used in conjunction with Cayman’s Adipose Triglyceride Lipase polyclonal antibody (Catalog No. 10006409) to block...
      
      
      Reference: 10009266-1
      
      
    
    
    €0.00
            (tax incl.)
    
    
    
    
    
            
    
    
  
      
      
              
      Peptide Sequence:  human SREBP-2 protein amino acids 455-469 (SPLLDDAKVKDEPDS) · To be used in conjunction with Cayman’s SREBP-2 polyclonal antibody (Catalog No. 10007663) to block protein-antibody complex formation...
      
      
      Reference: 10009324-1
      
      
    
    
    €0.00
            (tax incl.)
    
    
    
    
    
            
    
    
  
      
      
              
      Amino acids: Human LCAT protein amino acids 132-143 · To be used in conjunction with Cayman’s LCAT Polyclonal Antibody (Item No. 10009323) to block protein-antibody complex formation during immunochemical analysis of...
      
      
      Reference: 10009368-1
      
      
    
    
    €0.00
            (tax incl.)
    
    
    
    
    
            
    
    
  
      
      
              
      Antigen:  human TP receptor C-terminal amino acids 323-343  (LSTRPRSLSLQPQLTQRSGLQ) · Host:  rabbit · Cross-reactivity:  (+) human, murine,  rat, and Cos-7 (African green monkey) TP receptor; other species not tested...
      
      
      Reference: 10009581-1
      
      
    
    
    €0.00
            (tax incl.)
    
    
    
    
    
            
    
    
  
      
      
              
      Peptide Sequence:  Mouse PCSK9 amino acids 152-163 (VFAQSIPWNLER) · To be used in conjunction with Cayman’s PCSK9 (mouse) Polyclonal Antibody (Item No. 10008811) to block protein-antibody complex formation during...
      
      
      Reference: 10010251-1
      
      
    
    
    €0.00
            (tax incl.)
    
    
    
    
    
            
    
    
  
      
      
              
      Peptide Sequence:  synthetic peptide from human cRBP7 amino acids 125-134 (QVCKQTFQRA) · To be used in conjunction with Cayman’s Cellular Retinol Binding Protein 7 polyclonal antibody (Catalog No. 10010251) to block...
      
      
      Reference: 101780-200
      
      
    
    
    €0.00
            (tax incl.)
    
    
    
    
    
            
    
    
  
      
      
              
      Peptide Sequence:  human amino acids 1-23 (MSTPGVNSSASLSPDRLNSPVTI)(3164,3185,3186,2035) · To be used in conjunction with Cayman’s EP4 receptor polyclonal antiserum (Catalog No. 101770) to block protein-antibody...
      
      
      Reference: 10225-200
      
      
    
    
    €0.00
            (tax incl.)
    
    
    
    
    
            
    
    
  
      
      
              
      To be used in conjunction with Cayman’s GPR55 Polyclonal Antibody to block protein-antibody complex formation during immunochemical analysis of GPR55 for WB
      
      
      Reference: 11188-25
      
      
    
    
    €0.00
            (tax incl.)
    
    
    
    
    
            
    
    
  
      
      
              
      Peptide sequence: PGP • PGP is a tripeptide molecule and an established biomarker for COPD and CF. PGP functions as a neutrophil chemoattractant and is derived from the proteolytic cleavage of collagen in the...
      
      
      Reference: 11188-5
      
      
    
    
    €0.00
            (tax incl.)
    
    
    
    
    
            
    
    
  
      
      
              
      Peptide sequence: PGP • PGP is a tripeptide molecule and an established biomarker for COPD and CF. PGP functions as a neutrophil chemoattractant and is derived from the proteolytic cleavage of collagen in the...
      
      
      Reference: 11189-25
      
      
    
    
    €0.00
            (tax incl.)
    
    
    
    
    
            
    
    
  
      
      
              
      Peptide sequence: N-terminal acetylated-PGP • N-acetyl-PGP is a tripeptide that functions as a neutrophil chemoattractant.  N-acetyl-PGP and PGP induce the recruitment of neutrophils (PMN) through stimulation of...
      
      
      Reference: 11189-5
      
      
    
    
    €0.00
            (tax incl.)
    
    
    
    
    
            
    
    
  
      
      
              
      Peptide sequence: N-terminal acetylated-PGP • N-acetyl-PGP is a tripeptide that functions as a neutrophil chemoattractant.  N-acetyl-PGP and PGP induce the recruitment of neutrophils (PMN) through stimulation of...
      
      
      Reference: 120112-200
      
      
    
    
    €0.00
            (tax incl.)
    
    
    
    
    
            
    
    
  
      
      
              
      Peptide Sequence:  human amino acids 331-352 (ALEPGPSESLTASSPLKLNELN)(4425) · To be used in conjunction with Cayman’s BLT1 receptor polyclonal antibodies (Catalog Nos. 100019 and 120114) to block protein-antibody...
      
      
      Reference: 160604-200
      
      
    
    
    €0.00
            (tax incl.)
    
    
    
    
    
            
    
    
  
      
      
              
      To be used in conjunction with Cayman’s PAF receptor polyclonal antiserum (Catalog No. 160602) to block protein-antibody complex formation during analysis for the PAF receptor.
      
      
      Reference: 300830-200
      
      
    
    
    €0.00
            (tax incl.)
    
    
    
    
    
            
    
    
  
      
      
              
      Peptide Sequence:  rat Cav-3 amino acids 19-41 (CKEIDLVNRDPKNINEDIVKVDF)(3942) · To be used in conjunction with Cayman’s caveolin 1/3 polyclonal antibody (Catalog No. 100830) to block protein-antibody complex...
      
      
      Reference: 200200-1
      
      
    
    
    €0.00
            (tax incl.)
    
    
    
    
    
            
    
    
  
      
      
              
      The acridinium NHS ester can be used to label proteins and nucleic acids. The covalently bound acridinium NHS ester will produce chemiluminescence in the presence of hydrogen peroxide. Acridinium-labeled proteins can...
      
      
      Reference: 200200-10
      
      
    
    
    €0.00
            (tax incl.)
    
    
    
    
    
            
    
    
  
      
      
              
      The acridinium NHS ester can be used to label proteins and nucleic acids. The covalently bound acridinium NHS ester will produce chemiluminescence in the presence of hydrogen peroxide. Acridinium-labeled proteins can...
      
      
      Reference: 200200-5
      
      
    
    
    €0.00
            (tax incl.)
    
    
    
    
    
            
    
    
  
      
      
              
      The acridinium NHS ester can be used to label proteins and nucleic acids. The covalently bound acridinium NHS ester will produce chemiluminescence in the presence of hydrogen peroxide. Acridinium-labeled proteins can...
      
      
      Reference: 200200-50
      
      
    
    
    €0.00
            (tax incl.)
    
    
    
    
    
            
    
    
  
      
      
              
      The acridinium NHS ester can be used to label proteins and nucleic acids. The covalently bound acridinium NHS ester will produce chemiluminescence in the presence of hydrogen peroxide. Acridinium-labeled proteins can...
      
      
      Reference: 21426-10
      
      
    
    
    €0.00
            (tax incl.)
    
    
    
    
    
            
    
    
  
      
      
              
      A cell-permeant fluorogenic dye used to assess mitochondrial function and cell viability; excitation/emission spectra 550/575 nm
      
      
      Reference: 21426-25
      
      
    
    
    €0.00
            (tax incl.)
    
    
    
    
    
            
    
    
  
      
      
              
      A cell-permeant fluorogenic dye used to assess mitochondrial function and cell viability; excitation/emission spectra 550/575 nm
      
      
      Reference: 21426-5
      
      
    
    
    €0.00
            (tax incl.)
    
    
    
    
    
            
    
    
  
      
      
              
      A cell-permeant fluorogenic dye used to assess mitochondrial function and cell viability; excitation/emission spectra 550/575 nm
      
      
      Reference: 21426-50
      
      
    
    
    €0.00
            (tax incl.)
    
    
    
    
    
            
    
    
  
      
      
              
      A cell-permeant fluorogenic dye used to assess mitochondrial function and cell viability; excitation/emission spectra 550/575 nm
      
      
      Reference: 21437-10
      
      
    
    
    €0.00
            (tax incl.)
    
    
    
    
    
            
    
    
  
      
      
              
      A cell-permeant fluorogenic dye used to assess mitochondrial function and cell viability; excitation/emission spectra 515 and 555/575 nm
      
      
      Reference: 21437-25
      
      
    
    
    €0.00
            (tax incl.)
    
    
    
    
    
            
    
    
  
      
      
              
      A cell-permeant fluorogenic dye used to assess mitochondrial function and cell viability; excitation/emission spectra 515 and 555/575 nm
      
      
      Reference: 21437-5
      
      
    
    
    €0.00
            (tax incl.)
    
    
    
    
    
            
    
    
  
      
      
              
      A cell-permeant fluorogenic dye used to assess mitochondrial function and cell viability; excitation/emission spectra 515 and 555/575 nm
      
      
      Reference: 21437-50
      
      
    
    
    €0.00
            (tax incl.)
    
    
    
    
    
            
    
    
  
      
      
              
      A cell-permeant fluorogenic dye used to assess mitochondrial function and cell viability; excitation/emission spectra 515 and 555/575 nm
      
      
      Reference: 24319-100
      
      
    
    
    €0.00
            (tax incl.)
    
    
    
    
    
            
    
    
  
      
      
              
      An alkyne derivative of cholesterol for click chemistry; has been used to track cholesterol metabolism and localization
      
      
      Reference: 24319-250
      
      
    
    
    €0.00
            (tax incl.)
    
    
    
    
    
            
    
    
  
      
      
              
      An alkyne derivative of cholesterol for click chemistry; has been used to track cholesterol metabolism and localization
      
      
      Reference: 24319-500
      
      
    
    
    €0.00
            (tax incl.)
    
    
    
    
    
            
    
    
  
      
      
              
      An alkyne derivative of cholesterol for click chemistry; has been used to track cholesterol metabolism and localization
      
      
      Reference: 24618-1
      
      
    
    
    €0.00
            (tax incl.)
    
    
    
    
    
            
    
    
  
      
      
              
      A fluorescently-tagged cholesterol; co-localizes with dehydroergosterol in HeLa cells and is trafficked from the plasma membrane to the endocytic recycling compartment in BHK cells; ex/em = 480/508 nm, respectively;...
      
      
      Reference: 24618-10
      
      
    
    
    €0.00
            (tax incl.)
    
    
    
    
    
            
    
    
  
      
      
              
      A fluorescently-tagged cholesterol; co-localizes with dehydroergosterol in HeLa cells and is trafficked from the plasma membrane to the endocytic recycling compartment in BHK cells; ex/em = 480/508 nm, respectively;...
      
      
      Reference: 24618-5
      
      
    
    
    €0.00
            (tax incl.)
    
    
    
    
    
            
    
    
  
      
      
              
      A fluorescently-tagged cholesterol; co-localizes with dehydroergosterol in HeLa cells and is trafficked from the plasma membrane to the endocytic recycling compartment in BHK cells; ex/em = 480/508 nm, respectively;...
      
      
      Reference: 24618-500
      
      
    
    
    €0.00
            (tax incl.)
    
    
    
    
    
            
    
    
  
      
      
              
      A fluorescently-tagged cholesterol; co-localizes with dehydroergosterol in HeLa cells and is trafficked from the plasma membrane to the endocytic recycling compartment in BHK cells; ex/em = 480/508 nm, respectively;...
      
      
      Reference: 27091-1
      
      
    
    
    €0.00
            (tax incl.)
    
    
    
    
    
            
    
    
  
      
      
              
      SureLight® 488 is a bright green fluorescent dye with excitation suited to the 488 nm laser line, fluorescent microscopy, and flow cytometry. The NHS ester version is an efficient amine reactive probe that can be used...
      
      
      Reference: 27091-100
      
      
    
    
    €0.00
            (tax incl.)
    
    
    
    
    
            
    
    
  
      
      
              
      SureLight® 488 is a bright green fluorescent dye with excitation suited to the 488 nm laser line, fluorescent microscopy, and flow cytometry. The NHS ester version is an efficient amine reactive probe that can be used...
      
      
      Reference: 27108-100
      
      
    
    
    €0.00
            (tax incl.)
    
    
    
    
    
            
    
    
  
      
      
              
      A fluorescently labeled amyloid-β peptide; ex/em = 492/518 nm
      
      
      Reference: 27110-125
      
      
    
    
    €0.00
            (tax incl.)
    
    
    
    
    
            
    
    
  
      
      
              
      A fluorescently labeled amyloid-β peptide; ex/em = 543/572 nm
      
      
      Reference: 27183-10
      
      
    
    
    €0.00
            (tax incl.)
    
    
    
    
    
            
    
    
  
      
      
              
      A nonpeptide substrate of proteases and deiminases; has been used as a substrate for the relative quantification of trypsin activity; has also been used as a substrate for the activity of subtilisins, kallikreins, and...
      
      
      Reference: 27183-5
      
      
    
    
    €0.00
            (tax incl.)
    
    
    
    
    
            
    
    
  
      
      
              
      A nonpeptide substrate of proteases and deiminases; has been used as a substrate for the relative quantification of trypsin activity; has also been used as a substrate for the activity of subtilisins, kallikreins, and...
      
      
      Reference: 27183-50
      
      
    
    
    €0.00
            (tax incl.)
    
    
    
    
    
            
    
    
  
      
      
              
      A nonpeptide substrate of proteases and deiminases; has been used as a substrate for the relative quantification of trypsin activity; has also been used as a substrate for the activity of subtilisins, kallikreins, and...
      
      
      Reference: 27408-500
      
      
    
    
    €0.00
            (tax incl.)
    
    
    
    
    
            
    
    
  
      
      
              
      A fluorescently labeled amyloid-β peptide; ex/em = 492/518 nm
      
      
      Reference: 27409-1
      
      
    
    
    €0.00
            (tax incl.)
    
    
    
    
    
            
    
    
  
      
      
              
      A fluorescently labeled amyloid-β peptide; ex/em = 543/572 nm, respectively
      
      
      Reference: 27410-100
      
      
    
    
    €0.00
            (tax incl.)
    
    
    
    
    
            
    
    
  
      
      
              
      An affinity probe for Aβ42 binding partners; has been used to identify Aβ42 interaction partners in rat hippocampal synaptosomal membranes
      
      
      Reference: 27410-500
      
      
    
    
    €0.00
            (tax incl.)
    
    
    
    
    
            
    
    
  
      
      
              
      An affinity probe for Aβ42 binding partners; has been used to identify Aβ42 interaction partners in rat hippocampal synaptosomal membranes
      
      
      Reference: 27411-500
      
      
    
    
    €0.00
            (tax incl.)
    
    
    
    
    
            
    
    
  
      
      
              
      An affinity probe for Aβ40 binding partners; has been used to characterize Aβ40 distribution amongst the lipoprotein fractions and identify Aβ40 interaction partners in human plasma,
      
      
      Reference: 27412-100
      
      
    
    
    €0.00
            (tax incl.)
    
    
    
    
    
            
    
    
  
      
      
              
      A fluorescently labeled amyloid-β peptide; ex/em = 492/518 nm
      
      
      Reference: 27412-500
      
      
    
    
    €0.00
            (tax incl.)
    
    
    
    
    
            
    
    
  
      
      
              
      A fluorescently labeled amyloid-β peptide; ex/em = 492/518 nm
      
      
      Reference: 27413-500
      
      
    
    
    €0.00
            (tax incl.)
    
    
    
    
    
            
    
    
  
      
      
              
      A fluorescently labeled amyloid-β peptide; ex/em = 543/572
      
      
      Reference: 27439-1
      
      
    
    
    €0.00
            (tax incl.)
    
    
    
    
    
            
    
    
  
      
      
              
      A peptide substrate for CRK3/CYC6; phosphorylated by CRK3/CYC6 and has been used in high-throughput screening assays for the identification of CRK3/CYC6 inhibitors
      
      
      Reference: 27758-1
      
      
    
    
    €0.00
            (tax incl.)
    
    
    
    
    
            
    
    
  
      
      
              
      An amine-reactive fluorescent probe; has been used, linked to adenosine A1 receptor ligands, as a fluorescent probe to quantify ligand-receptor binding; ex/em = 630/650 nm, respectively
      
      
      Reference: 27758-5
      
      
    
    
    €0.00
            (tax incl.)
    
    
    
    
    
            
    
    
  
      
      
              
      An amine-reactive fluorescent probe; has been used, linked to adenosine A1 receptor ligands, as a fluorescent probe to quantify ligand-receptor binding; ex/em = 630/650 nm, respectively
      
      
      Reference: 300000-1
      
      
    
    
    €0.00
            (tax incl.)
    
    
    
    
    
            
    
    
  
      
      
              
      The peptide is identical among human, mous, and rat optineurin, amino acids 559-575 (GEVLPDIDTLQIHVMDC). This blocking peptide can be used in conjunction with Cayman’s Optineurin (C-Term) Polyclonal Antibody (Catalog...
      
      
      Reference: 300002-1
      
      
    
    
    €0.00
            (tax incl.)
    
    
    
    
    
            
    
    
  
      
      
              
      Peptide Sequence:  human optineurin amino acids 115-130 (KGKSERSSEDPTDDSR) · To be used in conjunction with Cayman’s optineurin (INT) polyclonal antibody (Catalog No. 100002) to block protein-antibody complex...
      
      
      Reference: 300003-1
      
      
    
    
    €0.00
            (tax incl.)
    
    
    
    
    
            
    
    
  
      
      
              
      Peptide Sequence:  HIF-1α protein amino acids (SRNLLQGEELLRALDQVN) · To be used in conjunction with Cayman’s HIF-1α Polyclonal Antibody (Item No. 10006421) to block protein-antibody complex formation during...
      
      
      Reference: 300011-1
      
      
    
    
    €0.00
            (tax incl.)
    
    
    
    
    
            
    
    
  
      
      
              
      Peptide Sequence:  human CD36 sequence amino acids 98-114 (AKENVTQDAEDNTVSF) · To be used in conjunction with Cayman’s CD36 polyclonal antibody (Catalog No. 100011) to block protein-antibody complex formation during...
      
      
      Reference: 300012-1
      
      
    
    
    €0.00
            (tax incl.)
    
    
    
    
    
            
    
    
  
      
      
              
      Peptide Sequence:  amino acids 221-235 (VYGGKEARTEEMKWR) · To be used in conjunction with Cayman’s mPGE synthase-2 polyclonal antibody (Catalog No. 160145) to block protein-antibody complex formation during analysis...
      
      
      Reference: 300013-1
      
      
    
    
    €0.00
            (tax incl.)
    
    
    
    
    
            
    
    
  
      
      
              
      Peptide Sequence:  human β-catenin amino acids 43-62 (APSLSGKGNPEEEDVDTSQV) · To be used in conjunction with Cayman’s β-catenin polyclonal antibody (Catalog No. 100029) to block protein-antibody complex formation...
      
      
      Reference: 300014-1
      
      
    
    
    €0.00
            (tax incl.)
    
    
    
    
    
            
    
    
  
      
      
              
      Peptide Sequence:  human monoacylglycerol lipase blocking peptide amino acids 1-14 (MPEESSPRRTPQSI) · To be used in conjunction with Cayman’s Monoacylglycerol Lipase Polyclonal Antibody (Item No. 100035) to block...
      
      
      Reference: 301550-200
      
      
    
    
    €0.00
            (tax incl.)
    
    
    
    
    
            
    
    
  
      
      
              
      Peptide Sequence:  human CB2 receptor sequence amino acids 20-33 (NPMKDYMILSGPQK)(6724) · To be used in conjunction with Cayman’s CB2 receptor polyclonal antibody (Catalog No. 101550) to block protein-antibody complex...
      
      
      Reference: 301600-1
      
      
    
    
    €0.00
            (tax incl.)
    
    
    
    
    
            
    
    
  
      
      
              
      Peptide Sequence:  rat FAAH amino acids sequence 561-579 (CLRFMREVEQLMTPQKQPS)(9140) · To be used in conjunction with Cayman’s FAAH polyclonal antibody (Catalog No. 101600) to block protein-antibody complex formation...
      
      
      Reference: 301640-1
      
      
    
    
    €0.00
            (tax incl.)
    
    
    
    
    
            
    
    
  
      
      
              
      To be used in conjunction with Cayman’s DP1 Receptor Polyclonal Antibody (Catalog No. 101640) to block protein-antibody complex formation during immunochemical analysis of the DP1 receptor.
      
      
      Reference: 301700-1
      
      
    
    
    €0.00
            (tax incl.)
    
    
    
    
    
            
    
    
  
      
      
              
      Peptide Sequence:  human PPARγ1 amino acids 82-101 (PASPPYYSEKTQLYNKPHEE; amino acids 110-129 of PPARγ2) · To be used in conjunction with Cayman’s PPARγ polyclonal antibody (Catalog No. 101700) to block...
      
      
      Reference: 301710-1
      
      
    
    
    €0.00
            (tax incl.)
    
    
    
    
    
            
    
    
  
      
      
              
      Peptide sequence: human PPARα amino acids 22-36 (PLSEEFLQEMGNIQE)(6160) · To be used in conjunction with Cayman’s PPARα polyclonal antibody (Item No. 101710) to block protein-antibody complex formation during analysis...
      
      
      Reference: 301740-1
      
      
    
    
    €0.00
            (tax incl.)
    
    
    
    
    
            
    
    
  
      
      
              
      Peptide Sequence:  human EP1 receptor C-terminal amino acids 380-402 (GLTPSAWEASSLRSSRHSGLSHF)(3176) · To be used in conjunction with Cayman’s EP1 receptor polyclonal antibody (Catalog No. 101740) to block...
      
      
      Reference: 301750-200
      
      
    
    
    €0.00
            (tax incl.)
    
    
    
    
    
            
    
    
  
      
      
              
      Peptide Sequence:  human EP2 receptor amino acids 335-358 (SLRTQDATQTSCSTQSDASKQADL)(3178) · To be used in conjunction with Cayman’s EP2 receptor polyclonal antibody (Catalog No. 101750) to block protein-antibody...
      
      
      Reference: 301760-1
      
      
    
    
    €0.00
            (tax incl.)
    
    
    
    
    
            
    
    
  
      
      
              
      Peptide Sequence:  human EP3 receptor sequence amino acids 308-327 (NQTSVEHCKTHTEKQKECNF)(3180,1900) · To be used in conjunction with Cayman’s EP3 receptor polyclonal antibody (Catalog No. 101760) to block...
      
      
      Reference: 301775-200
      
      
    
    
    €0.00
            (tax incl.)
    
    
    
    
    
            
    
    
  
      
      
              
      Peptide Sequence:  human EP4 receptor sequence amino acids 459-488 (GSGRAGPAPKGSSLQVTFPSETLNLSEKCI)(3164,3186) · To be used in conjunction with Cayman’s EP4 receptor polyclonal antibody (Catalog No. 101775) to block...
      
      
      Reference: 301785-200
      
      
    
    
    €0.00
            (tax incl.)
    
    
    
    
    
            
    
    
  
      
      
              
      Peptide Sequence:  human RICK sequence amino acids 11-30 (PTIPYHKLADLRYLSRGASG) · To be used in conjunction with Cayman’s RICK polyclonal antibody (Catalog No. 160785) to block protein-antibody complex formation...
      
      
      
            
Quote