Category: Peptides

Filter By
Brand: Agrisera Brand: Biosensis Brand: Cayman Chemical Brand: Chromotek Brand: FineTest Brand: Histosure Brand: MedChemExpress  Clear all
BODIPY 630/650X succinimide ester BODIPY 630/650X succinimide ester

BODIPY 630/650X succinimide ester

Reference: 27758-1
€0.00 (tax incl.)
An amine-reactive fluorescent probe; has been used, linked to adenosine A1 receptor ligands, as a fluorescent probe to quantify ligand-receptor binding; ex/em = 630/650 nm, respectively
BODIPY 630/650X succinimide ester BODIPY 630/650X succinimide ester

BODIPY 630/650X succinimide ester

Reference: 27758-5
€0.00 (tax incl.)
An amine-reactive fluorescent probe; has been used, linked to adenosine A1 receptor ligands, as a fluorescent probe to quantify ligand-receptor binding; ex/em = 630/650 nm, respectively
Optineurin (C-Term) Blocking Peptide Optineurin (C-Term) Blocking Peptide

Optineurin (C-Term) Blocking Peptide

Reference: 300000-1
€0.00 (tax incl.)
The peptide is identical among human, mous, and rat optineurin, amino acids 559-575 (GEVLPDIDTLQIHVMDC). This blocking peptide can be used in conjunction with Cayman’s Optineurin (C-Term) Polyclonal Antibody (Catalog...
Optineurin (INT) Blocking Peptide Optineurin (INT) Blocking Peptide

Optineurin (INT) Blocking Peptide

Reference: 300002-1
€0.00 (tax incl.)
Peptide Sequence: human optineurin amino acids 115-130 (KGKSERSSEDPTDDSR) · To be used in conjunction with Cayman’s optineurin (INT) polyclonal antibody (Catalog No. 100002) to block protein-antibody complex...
HIF-1α (C-Term) Blocking Peptide HIF-1α (C-Term) Blocking Peptide

HIF-1α (C-Term) Blocking Peptide

Reference: 300003-1
€0.00 (tax incl.)
Peptide Sequence: HIF-1α protein amino acids (SRNLLQGEELLRALDQVN) · To be used in conjunction with Cayman’s HIF-1α Polyclonal Antibody (Item No. 10006421) to block protein-antibody complex formation during...
CD36 Blocking Peptide CD36 Blocking Peptide

CD36 Blocking Peptide

Reference: 300011-1
€0.00 (tax incl.)
Peptide Sequence: human CD36 sequence amino acids 98-114 (AKENVTQDAEDNTVSF) · To be used in conjunction with Cayman’s CD36 polyclonal antibody (Catalog No. 100011) to block protein-antibody complex formation during...
Prostaglandin E Synthase-2 (microsomal) Blocking Peptide Prostaglandin E Synthase-2 (microsomal) Blocking Peptide

Prostaglandin E Synthase-2 (microsomal) Blocking Peptide

Reference: 300012-1
€0.00 (tax incl.)
Peptide Sequence: amino acids 221-235 (VYGGKEARTEEMKWR) · To be used in conjunction with Cayman’s mPGE synthase-2 polyclonal antibody (Catalog No. 160145) to block protein-antibody complex formation during analysis...
β-Catenin Blocking Peptide β-Catenin Blocking Peptide

β-Catenin Blocking Peptide

Reference: 300013-1
€0.00 (tax incl.)
Peptide Sequence: human β-catenin amino acids 43-62 (APSLSGKGNPEEEDVDTSQV) · To be used in conjunction with Cayman’s β-catenin polyclonal antibody (Catalog No. 100029) to block protein-antibody complex formation...
Monoacylglycerol Lipase Blocking Peptide Monoacylglycerol Lipase Blocking Peptide

Monoacylglycerol Lipase Blocking Peptide

Reference: 300014-1
€0.00 (tax incl.)
Peptide Sequence: human monoacylglycerol lipase blocking peptide amino acids 1-14 (MPEESSPRRTPQSI) · To be used in conjunction with Cayman’s Monoacylglycerol Lipase Polyclonal Antibody (Item No. 100035) to block...
CB2 Receptor Blocking Peptide CB2 Receptor Blocking Peptide

CB2 Receptor Blocking Peptide

Reference: 301550-200
€0.00 (tax incl.)
Peptide Sequence: human CB2 receptor sequence amino acids 20-33 (NPMKDYMILSGPQK)(6724) · To be used in conjunction with Cayman’s CB2 receptor polyclonal antibody (Catalog No. 101550) to block protein-antibody complex...
Fatty Acid Amide Hydrolase Blocking Peptide Fatty Acid Amide Hydrolase Blocking Peptide

Fatty Acid Amide Hydrolase Blocking Peptide

Reference: 301600-1
€0.00 (tax incl.)
Peptide Sequence: rat FAAH amino acids sequence 561-579 (CLRFMREVEQLMTPQKQPS)(9140) · To be used in conjunction with Cayman’s FAAH polyclonal antibody (Catalog No. 101600) to block protein-antibody complex formation...
DP1 Receptor Blocking Peptide DP1 Receptor Blocking Peptide

DP1 Receptor Blocking Peptide

Reference: 301640-1
€0.00 (tax incl.)
To be used in conjunction with Cayman’s DP1 Receptor Polyclonal Antibody (Catalog No. 101640) to block protein-antibody complex formation during immunochemical analysis of the DP1 receptor.
PPARγ Blocking Peptide PPARγ Blocking Peptide

PPARγ Blocking Peptide

Reference: 301700-1
€0.00 (tax incl.)
Peptide Sequence: human PPARγ1 amino acids 82-101 (PASPPYYSEKTQLYNKPHEE; amino acids 110-129 of PPARγ2) · To be used in conjunction with Cayman’s PPARγ polyclonal antibody (Catalog No. 101700) to block...
PPARα Blocking Peptide PPARα Blocking Peptide

PPARα Blocking Peptide

Reference: 301710-1
€0.00 (tax incl.)
Peptide sequence: human PPARα amino acids 22-36 (PLSEEFLQEMGNIQE)(6160) · To be used in conjunction with Cayman’s PPARα polyclonal antibody (Item No. 101710) to block protein-antibody complex formation during analysis...
EP1 Receptor Blocking Peptide EP1 Receptor Blocking Peptide

EP1 Receptor Blocking Peptide

Reference: 301740-1
€0.00 (tax incl.)
Peptide Sequence: human EP1 receptor C-terminal amino acids 380-402 (GLTPSAWEASSLRSSRHSGLSHF)(3176) · To be used in conjunction with Cayman’s EP1 receptor polyclonal antibody (Catalog No. 101740) to block...
EP2 Receptor Blocking Peptide EP2 Receptor Blocking Peptide

EP2 Receptor Blocking Peptide

Reference: 301750-200
€0.00 (tax incl.)
Peptide Sequence: human EP2 receptor amino acids 335-358 (SLRTQDATQTSCSTQSDASKQADL)(3178) · To be used in conjunction with Cayman’s EP2 receptor polyclonal antibody (Catalog No. 101750) to block protein-antibody...
EP3 Receptor Blocking Peptide EP3 Receptor Blocking Peptide

EP3 Receptor Blocking Peptide

Reference: 301760-1
€0.00 (tax incl.)
Peptide Sequence: human EP3 receptor sequence amino acids 308-327 (NQTSVEHCKTHTEKQKECNF)(3180,1900) · To be used in conjunction with Cayman’s EP3 receptor polyclonal antibody (Catalog No. 101760) to block...
EP4 Receptor (C-Term) Blocking Peptide EP4 Receptor (C-Term) Blocking Peptide

EP4 Receptor (C-Term) Blocking Peptide

Reference: 301775-200
€0.00 (tax incl.)
Peptide Sequence: human EP4 receptor sequence amino acids 459-488 (GSGRAGPAPKGSSLQVTFPSETLNLSEKCI)(3164,3186) · To be used in conjunction with Cayman’s EP4 receptor polyclonal antibody (Catalog No. 101775) to block...
RICK Blocking Peptide RICK Blocking Peptide

RICK Blocking Peptide

Reference: 301785-200
€0.00 (tax incl.)
Peptide Sequence: human RICK sequence amino acids 11-30 (PTIPYHKLADLRYLSRGASG) · To be used in conjunction with Cayman’s RICK polyclonal antibody (Catalog No. 160785) to block protein-antibody complex formation...
BLT2 Receptor Blocking Peptide BLT2 Receptor Blocking Peptide

BLT2 Receptor Blocking Peptide

Reference: 320124-200
€0.00 (tax incl.)
Peptide sequence: human BLT2 receptor amino acids 325-338 (MELRTTPQLKVVGQ)(8743,8280,8525) · To be used in conjunction with Cayman’s BLT2 receptor polyclonal antibody (Catalog No. 120124) to block protein-antibody...
CysLT1 Receptor Blocking Peptide CysLT1 Receptor Blocking Peptide

CysLT1 Receptor Blocking Peptide

Reference: 320500-200
€0.00 (tax incl.)
Peptide Sequence: human CysLT1 receptor amino acids 318-337 (TYVPRKKASLPEKGEEICKV)(7174) · To be used in conjunction with Cayman’s CysLT1 receptor polyclonal antibody (Catalog No. 120500) to block protein-antibody...
CysLT2 Receptor (C-Term) Blocking Peptide CysLT2 Receptor (C-Term) Blocking Peptide

CysLT2 Receptor (C-Term) Blocking Peptide

Reference: 320550-1
€0.00 (tax incl.)
Peptide Sequence: human CysLT2 receptor amino acids 330-346 · To be used in conjunction with Cayman’s CysLT2 Receptor (C-Term) Polyclonal Antibody (Catalog No. 120550) to block protein-antibody complex formation...
CysLT2 Receptor (N-Term) Blocking Peptide CysLT2 Receptor (N-Term) Blocking Peptide

CysLT2 Receptor (N-Term) Blocking Peptide

Reference: 320560-200
€0.00 (tax incl.)
Peptide Sequence: human CysLT2 receptor N-terminal amino acids 1-18 (MERKFMSLQPSISVSEME)(8519,9059) · To be used in conjunction with Cayman’s CysLT2 receptor (N-term) polyclonal antibody (Catalog No. 120560) to block...
Prostaglandin D Synthase (lipocalin-type) Blocking Peptide Prostaglandin D Synthase (lipocalin-type) Blocking Peptide

Prostaglandin D Synthase (lipocalin-type) Blocking Peptide

Reference: 360003-200
€0.00 (tax incl.)
Peptide Sequence: human lipocalin-type PGD synthase amino acids 30-41 (VQPNFQPDKFLG)(8449) · To be used in conjunction with Cayman’s lipocalin-type PGD synthase polyclonal antibody (Catalog No. 160003) to block...
Prostaglandin D Synthase (hematopoietic-type) Blocking Peptide Prostaglandin D Synthase (hematopoietic-type) Blocking Peptide

Prostaglandin D Synthase (hematopoietic-type) Blocking Peptide

Reference: 360013-200
€0.00 (tax incl.)
Peptide Sequence: Human hematopoietic type PGD synthase amino acids 30-41 (EDHRIEQADWPE)(8451) · To be used in conjunction with Cayman’s hematopoietic type PGD synthase polyclonal antibody (Catalog No. 160013) to...
IP Receptor (mouse) Blocking Peptide IP Receptor (mouse) Blocking Peptide

IP Receptor (mouse) Blocking Peptide

Reference: 360070-1
€0.00 (tax incl.)
Peptide Sequence: human IP receptor amino acids · To be used in conjunction with Cayman’s IP receptor (mouse) polyclonal antibody (Item No. 160070) to block protein-antibody complex formation during immunochemical...
COX-2 (mouse) Blocking Peptide COX-2 (mouse) Blocking Peptide

COX-2 (mouse) Blocking Peptide

Reference: 360106-200
€0.00 (tax incl.)
Peptide Sequence: murine COX-2 amino acids 570-598 (DPQPTKTATINASASHSRLDDINPTVLIK)(1982) · To be used in conjunction with Cayman’s COX-2 (mouse) polyclonal antibodies (Item Nos. 160106, 160116, or 160126) to block...
COX-2 (human) Blocking Peptide COX-2 (human) Blocking Peptide

COX-2 (human) Blocking Peptide

Reference: 360107-200
€0.00 (tax incl.)
Peptide Sequence: human COX-2 amino acids 567-599 (SVPDPELIKTVTINASSSRSGLDDINPTVLLKE)(2) · To be used in conjunction with Cayman’s COX-2 (human) Polyclonal Antibody (Item No. 160107) or the COX-2 (human) monoclonal...
COX-1 (ovine) Blocking Peptide COX-1 (ovine) Blocking Peptide

COX-1 (ovine) Blocking Peptide

Reference: 360108-200
€0.00 (tax incl.)
Peptide Sequence: ovine COX-1 amino acids 272-282 (LMHYPRGIPPQ)(919) · To be used in conjunction with Cayman’s COX-1 (ovine) polyclonal antiserum (Catalog No. 160108) to block protein-antibody complex formation...
COX-1 (mouse) Blocking Peptide COX-1 (mouse) Blocking Peptide

COX-1 (mouse) Blocking Peptide

Reference: 360109-200
€0.00 (tax incl.)
Peptide Sequence: murine COX-1 amino acids 274-288 (LMRYPPGVPPERQMA)(300) · To be used in conjunction with Cayman’s COX-1 (mouse) polyclonal antibody (Item No. 160109) to block protein-antibody complex formation...
Prostaglandin E Synthase-1 (microsomal) Blocking Peptide Prostaglandin E Synthase-1 (microsomal) Blocking Peptide

Prostaglandin E Synthase-1 (microsomal) Blocking Peptide

Reference: 360140-1
€0.00 (tax incl.)
Peptide Sequence: human amino acids 59-75 (CRSDPDVERSLRAHRND)(7229) · To be used in conjunction with Cayman’s microsomal PGE synthase-1 polyclonal antibody (Catalog No. 160140) to block protein-antibody complex...
Prostaglandin E Synthase (cytosolic) Blocking Peptide Prostaglandin E Synthase (cytosolic) Blocking Peptide

Prostaglandin E Synthase (cytosolic) Blocking Peptide

Reference: 360150-1
€0.00 (tax incl.)
Peptide sequence: human cPGE synthase amino acids 58-67 (CIDPNDSKHK)(8691) · To be used in conjunction with Cayman’s cPGEsynthase polyclonal antibody (Catalog No. 160150) to block protein-antibody complex formation...
5-Lipoxygenase Blocking Peptide 5-Lipoxygenase Blocking Peptide

5-Lipoxygenase Blocking Peptide

Reference: 360402-200
€0.00 (tax incl.)
Peptide Sequence: human and rat amino acids 130-149 (QHRRKELETRQKQYRWMEWN)(4212,4211,4210) · To be used in conjunction with Cayman’s 5-LO polyclonal antiserum (Catalog No. 160402) to block protein-antibody complex...
sPLA2 (mouse Type V) Blocking Peptide sPLA2 (mouse Type V) Blocking Peptide

sPLA2 (mouse Type V) Blocking Peptide

Reference: 360512-200
€0.00 (tax incl.)
Peptide sequence: mouse group V sPLA2 amino acids 79-94 (CAIRTQSYDYRYTNGL) · To be used in conjunction with Cayman’s sPLA2 (mouse type V) polyclonal antibody (Item No. 160512) to block protein-antibody complex...
PAF Receptor Blocking Peptide (Monoclonal) PAF Receptor Blocking Peptide (Monoclonal)

PAF Receptor Blocking Peptide (Monoclonal)

Reference: 360600-1
€0.00 (tax incl.)
Peptide Sequence: human amino acids 260-269 (LGFQDSKFHQ).(5109,5148,5150) · To be used in conjunction with Cayman’s PAF receptor monoclonal antibody (Catalog No. 160600) to block protein-antibody complex formation...
PAF Acetylhydrolase Blocking Peptide PAF Acetylhydrolase Blocking Peptide

PAF Acetylhydrolase Blocking Peptide

Reference: 360603-200
€0.00 (tax incl.)
Peptide Sequence: human C-terminal amino acids 420-441 (TNINTTNQHIMLQNSSGIEKYN)(2618) · To be used in conjunction with Cayman’s PAF-AH polyclonal antiserum (Catalog No. 160603) to block protein-antibody complex...
15-hydroxy Prostaglandin Dehydrogenase Blocking Peptide 15-hydroxy Prostaglandin Dehydrogenase Blocking Peptide

15-hydroxy Prostaglandin Dehydrogenase Blocking Peptide

Reference: 360615-200
€0.00 (tax incl.)
Peptide Sequence: amino acids 92-105 (AGVNNEKNWEKTLQ) from the human NAD+-dependent 15-hydroxy PGDH(387) · To be used in conjunction with Cayman’s 15-hydroxy PGDH polyclonal antibody (Catalog No. 160615) to block...
Prostaglandin I Synthase Blocking Peptide Prostaglandin I Synthase Blocking Peptide

Prostaglandin I Synthase Blocking Peptide

Reference: 360640-200
€0.00 (tax incl.)
Peptide Sequence: bovine amino acids 299-329 (LLKNPEALAAVRGELETVLLGAEQPISQMTT)(3477,3476,3478) · To be used in conjunction with Cayman’s PGIS polyclonal antibody (Catalog No. 160640) to block protein-antibody complex...
Thromboxane Synthase Blocking Peptide Thromboxane Synthase Blocking Peptide

Thromboxane Synthase Blocking Peptide

Reference: 360715-200
€0.00 (tax incl.)
Peptide Sequence: human amino acids 359-377 (TNPDCQEKLLREVDVFKEK)(50,4150) · To be used in conjunction with Cayman’s thromboxane synthase polyclonal antibody (Catalog No. 160715) to block protein-antibody complex...
Caspase-3 (human) Blocking Peptide Caspase-3 (human) Blocking Peptide

Caspase-3 (human) Blocking Peptide

Reference: 360745-200
€0.00 (tax incl.)
Peptide Sequence: human caspase-3 sequence amino acids 166-183 (TELDSGIETDSGVDDDMA)(8444) · To be used in conjunction with Cayman’s Caspase-3 (human) Polyclonal Antibody (Catalog No. 160745) to block protein-antibody...
AIF Blocking Peptide AIF Blocking Peptide

AIF Blocking Peptide

Reference: 360773-1
€0.00 (tax incl.)
Peptide Sequence: human AIF amino acids 151-180 (RARDPGARVLIVSEDPELPYMRPPLSKELW) · To be used in conjunction with Cayman’s AIF polyclonal antibody (Catalog No. 160773) to block protein-antibody complex formation...
Apaf-1 Blocking Peptide Apaf-1 Blocking Peptide

Apaf-1 Blocking Peptide

Reference: 360780-200
€0.00 (tax incl.)
Peptide Sequence: human Apaf-1 amino acids 12-28 (HREALEKDIKTSYIMDHC); the sequence of the peptide is identical between human and mouse.(6894,6873) · To be used in conjunction with Cayman’s Apaf-1 polyclonal antibody...
nNOS Blocking Peptide nNOS Blocking Peptide

nNOS Blocking Peptide

Reference: 360871-200
€0.00 (tax incl.)
Peptide Sequence: human nNOS amino acids 1422-1433 (ESKKDTDEVFSS)(1280,4153) · To be used in conjunction with Cayman’s nNOS polyclonal antibody (Catalog No. 160870) to block protein-antibody complex formation during...
eNOS Blocking Peptide eNOS Blocking Peptide

eNOS Blocking Peptide

Reference: 360881-200
€0.00 (tax incl.)
Peptide Sequence: human eNOS amino acids 1186-1203 (RGAVPWAFDPPGSDTNS) · To be used in conjunction with Cayman’s eNOS polyclonal antiserum (Item No. 160880) to block protein-antibody complex formation during analysis...
Guanylate Cyclase α subunit (soluble) Blocking Peptide Guanylate Cyclase α subunit (soluble) Blocking Peptide

Guanylate Cyclase α subunit (soluble) Blocking Peptide

Reference: 360895-200
€0.00 (tax incl.)
Peptide sequences: human guanylate cyclase α subunit amino acids 418-436 (EQARAQDGLKKRLGKLKAT) · To be used in conjunction with Cayman’s guanylate cyclase α subunit polyclonal antibody (Catalog No. 160895) to block...
Guanylate Cyclase β1 subunit (soluble) Blocking Peptide Guanylate Cyclase β1 subunit (soluble) Blocking Peptide

Guanylate Cyclase β1 subunit (soluble) Blocking Peptide

Reference: 360897-200
€0.00 (tax incl.)
Peptide Sequence: soluble rat guanylate cyclase β1 subunit, amino acids 188-207 (EDFYEDLDRFEENGTQDSR; last D=E in human and bovine)(3531,4654,3535) · To be used in conjunction with Cayman’s guanylate cyclase β1...
V5-peptide V5-peptide

V5-peptide

Reference: v5p-1
€0.00 (tax incl.)
1 mg V5-peptide.
Spot-peptide Spot-peptide

Spot-peptide

Reference: ep-10
€0.00 (tax incl.)
10 mg Spot-peptide.
Spot-peptide Spot-peptide

Spot-peptide

Reference: ep-1
€0.00 (tax incl.)
1 mg Spot-peptide.
2xMyc-peptide 2xMyc-peptide

2xMyc-peptide

Reference: 2yp-1
€0.00 (tax incl.)
1 mg 2xMyc-peptide.
Recombinant Human Myostatin Propeptide Recombinant Human Myostatin Propeptide

Recombinant Human Myostatin Propeptide

Reference: P4084
€0.00 (tax incl.)
Synonyms: Cmpt, GDF-8, GDF8_HUMAN, Growth/differentiation factor 8, MSLHP, MSTN, MSTN myostatin, Myostatin, Myostatin Propeptide. Lyophilized from a 0.2um filtered solution in PBS with 5% trehalose, pH7.4
Recombinant Human Natriuretic Peptide Receptor A Recombinant Human Natriuretic Peptide Receptor A

Recombinant Human Natriuretic Peptide Receptor A

Reference: P4799
€0.00 (tax incl.)
Synonyms: ANP-A, ANPa, ANPR-A, ANPRA, ANPRA_HUMAN, Atrial natriuretic peptide A type receptor, Atrial natriuretic peptide receptor 1, Atrial natriuretic peptide receptor A, Atrial natriuretic peptide receptor type A,...
CD11c CD11c

CD11c

Reference: 375-0P
€0.00 (tax incl.)
Integrin alpha-X, ITGAX, CD11c
Amyloid beta, 1-42, HFIP-treated Purified Peptide-50 μg Amyloid beta, 1-42, HFIP-treated Purified Peptide-50 μg

Amyloid beta, 1-42, HFIP-treated Purified Peptide-50 μg

Reference: PE-1749-50
€0.00 (tax incl.)
Synthetic beta-amyloid Aβ1-42 was monomerized by HFIP (hexafluoro-2-propanol) treatment and dried. One vial contains 50 μg monomeric Aβ peptide that can be used to form solutions of unaggregated Aβ monomers,...
Amyloid beta, 1-42, oligomeric, Stabilized Peptide-2 x 500 ng Amyloid beta, 1-42, oligomeric, Stabilized Peptide-2 x 500 ng

Amyloid beta, 1-42, oligomeric, Stabilized Peptide-2 x 500 ng

Reference: PE-1750-1000
€0.00 (tax incl.)
A proprietary preparation of human amyloid beta peptide (amino acids 1-42) that was initially monomerized by HFIP-treatment and then allowed to form oligomers by the procedure described in Youmans KL et al., 2012,...
Z-Val-Gly-OH Z-Val-Gly-OH

Z-Val-Gly-OH

Reference: HY-W048830
€0.00 (tax incl.)
Z-Val-Gly-OH is a N-benzyloxycarbonyl (Z)-dipeptide.
Z-VEID-FMK Z-VEID-FMK

Z-VEID-FMK

Reference: HY-P1007
€0.00 (tax incl.)
Z-VEID-FMK is a selective inhibitor of caspase-6. Z-VEID-FMK can be used for the research of tumor.
Hexa-His TFA Hexa-His TFA

Hexa-His TFA

Reference: HY-P0294A
€0.00 (tax incl.)
Hexa-His TFA is a peptide consisting of 6 His residues, used as a metal binding site for the recombinant protein.
Insulin icodec Insulin icodec

Insulin icodec

Reference: HY-P4070
€0.00 (tax incl.)
Insulin icodec is a basal insulin analog. Insulin icodec can be used for the research of type 2 diabetes.
mTRP-2 (180-188) mTRP-2 (180-188)

mTRP-2 (180-188)

Reference: HY-P1827
€0.00 (tax incl.)
mTRP-2 (180-188) is a murine tyrosinase-related protein 2 (TRP-2) -derived peptide, corresponding to residues 180-188. TRP-2 (180-188) is identified as the major reactive epitope within TRP-2 recognized by anti-B16 CTLs.
Shepherdin (79-87) Shepherdin (79-87)

Shepherdin (79-87)

Reference: HY-P1750
€0.00 (tax incl.)
Shepherdin (79-87) is amino acids 79 to 87 fragment of Shepherdin. Shepherdin is a peptidomimetic antagonist of the complex between Hsp90 and Survivin. Anticancer activity.
Human PD-L1 inhibitor I Human PD-L1 inhibitor I

Human PD-L1 inhibitor I

Reference: HY-P2474
€0.00 (tax incl.)
Human PD-L1 inhibitor I is a hPD-1 peptide ligand, with a KD of 3.39 μM. Human PD-L1 inhibitor I may disturb the binding of hPD-L1 to hPD-1.
K41498 K41498

K41498

Reference: HY-P1106
€0.00 (tax incl.)
K41498 is a potent and highly selective CRF2 receptor antagonist with Ki values of 0.66 nM, 0.62 nM and 425 nM for human CRF2α, CRF2β and CRF1 receptors respectively. K41498 is an analogues of antisauvagine-30...
Fmoc-Asp(OtBu)-Osu Fmoc-Asp(OtBu)-Osu

Fmoc-Asp(OtBu)-Osu

Reference: HY-137950
€0.00 (tax incl.)
Fmoc-Asp(OtBu)-Osu is an aspartic acid derivative.
FOXO4-DRI FOXO4-DRI

FOXO4-DRI

Reference: HY-P4157
€0.00 (tax incl.)
FOXO4-DRI is a cell-permeable peptide antagonist that blocks the interaction of FOXO4 and p53. FOXO4-DRI is a senolytic peptide that induces apoptosis of senescent cells.
Alamandine Alamandine

Alamandine

Reference: HY-P3108
€0.00 (tax incl.)
Alamandine, a member of the renin-angiotensin system (RAS), a vasoactive peptide, is an endogenous ligand of the G protein-coupled receptor MrgD. Alamandine targets to protect the kidney and heart through...
Pyr-Arg-Thr-Lys-Arg-AMC TFA Pyr-Arg-Thr-Lys-Arg-AMC TFA

Pyr-Arg-Thr-Lys-Arg-AMC TFA

Reference: HY-P4349A
€0.00 (tax incl.)
Pyr-Arg-Thr-Lys-Arg-AMC TFA is a AMC peptide. AMC is a decapeptide that is specifically hydrolyzed by proteases such as trypsin and thrombin. The AMC peptide can be used to determine the activity of protease and the...
Felypressin acetate Felypressin acetate

Felypressin acetate

Reference: HY-A0182A
€0.00 (tax incl.)
Felypressin acetate (PLV-2 acetate) is a non-catecholamine vasoconstrictor and a vasopressin 1 agonist. Felypressin acetate is widely used in dental procedures.
BeKm-1 TFA BeKm-1 TFA

BeKm-1 TFA

Reference: HY-P1440A
€0.00 (tax incl.)
BeKm-1 TFA is a potent and selective KV11.1 (hERG) channel blocker. BeKm-1 TFA is selective for KV11.1 over a panel of 14 other potassium channels. BeKm-1 TFA dose-dependently prolongs QTc interval in isolated rabbit...
Fmoc-Met-OH Fmoc-Met-OH

Fmoc-Met-OH

Reference: HY-W008371
€0.00 (tax incl.)
Fmoc-Met-OH is a Methionine (HY-13694) derivative.
[Met5]-Enkephalin, amide TFA [Met5]-Enkephalin, amide TFA

[Met5]-Enkephalin, amide TFA

Reference: HY-P1467A
€0.00 (tax incl.)
[Met5]-Enkephalin, amide TFA is an agonist for δ opioid receptors as well as putative ζ (zeta) opioid receptors.
Glutathione oxidized Glutathione oxidized

Glutathione oxidized

Reference: HY-D0844
€0.00 (tax incl.)
Glutathione oxidized (GSSG) is produced by the oxidation of glutathione. Detoxification of reactive oxygen species is accompanied by production of glutathione oxidized. Glutathione oxidized can be used for the...
Fibronectin Fibronectin

Fibronectin

Reference: HY-P3160
€0.00 (tax incl.)
Fibronectin, a glycoprotein (~500 kDa) present in blood as well as in cells, is a biomarker of tissue injury. Fibronectin binds to membrane-spanning receptor proteins called integrins. Fibronectin also binds to other...
Substance P (6-11) Substance P (6-11)

Substance P (6-11)

Reference: HY-P3889
€0.00 (tax incl.)
Substance P (6-11) is the C-terminal hexapeptideamide of Substance P (Substance P (HY-P0201)). Substance P (6-11) binds to NK-1 tachykinin receptor. Substance P (6-11) shows depolarization of motoneurons and a...
H-Phg(4-Cl)-OH H-Phg(4-Cl)-OH

H-Phg(4-Cl)-OH

Reference: HY-W005720
€0.00 (tax incl.)
H-Phg(4-Cl)-OH (L-4-Chlorophenylglycine) is a Glycine (HY-Y0966) derivative.
Tat-NR2B9c Tat-NR2B9c

Tat-NR2B9c

Reference: HY-P0117
€0.00 (tax incl.)
Tat-NR2B9c (Tat-NR2Bct; NA-1) is a postsynaptic density-95 (PSD-95) inhibitor, with EC50 values of 6.7 nM and 670 nM for PSD-95d2 (PSD-95 PDZ domain 2) and PSD-95d1, respectively. Tat-NR2B9c disrupts the PSD-95/NMDAR...
Argipressin diacetate Argipressin diacetate

Argipressin diacetate

Reference: HY-P0049A
€0.00 (tax incl.)
Argipressin (diacetate) (AVP (diacetate), also known as antidiuretic hormone (ADH)) is a 9 amino acid neuropeptide secreted by the posterior pituitary. Argipressin (diacetate) (AVP (diacetate)) can regulate the...
Buforin II Buforin II

Buforin II

Reference: HY-P1630
€0.00 (tax incl.)
Buforin II, derived from buforin I, a protein isolated from the stomach of the Asian toad Bufo bufo gargarizans, is a potent antimicrobial peptide. Buforin II has antimicrobial activity against a broad spectrum of...
Dynorphin A Dynorphin A

Dynorphin A

Reference: HY-P1333
€0.00 (tax incl.)
Dynorphin A is an endogenous opioid peptide involved in inhibitory neurotransmission in the central nervous system (CNS). Dynorphin A is a highy potent kappa opioid receptor (KOR) agonist, and is also an agonist for...
Ala-Arg-Arg-Pro-Glu-Gly-Arg-Thr-Trp-Ala-Gln-Pro-Gly-Tyr Ala-Arg-Arg-Pro-Glu-Gly-Arg-Thr-Trp-Ala-Gln-Pro-Gly-Tyr

Ala-Arg-Arg-Pro-Glu-Gly-Arg-Thr-Trp-Ala-Gln-Pro-Gly-Tyr

Reference: HY-P3941
€0.00 (tax incl.)
Ala-Arg-Arg-Pro-Glu-Gly-Arg-Thr-Trp-Ala-Gln-Pro-Gly-Tyr is a peptide. Ala-Arg-Arg-Pro-Glu-Gly-Arg-Thr-Trp-Ala-Gln-Pro-Gly-Tyr can easily be formed with more than one positive charge.
p2Ca p2Ca

p2Ca

Reference: HY-P0260
€0.00 (tax incl.)
p2Ca, an 8-mer peptide, is a ligand that is naturally processed and presented to the Ld-alloreactive T cell clone, 2C.
Cys-Gly-Tyr-Gly-Pro-Lys-Lys-Lys-Arg-Lys-Val-Gly-Gly Cys-Gly-Tyr-Gly-Pro-Lys-Lys-Lys-Arg-Lys-Val-Gly-Gly

Cys-Gly-Tyr-Gly-Pro-Lys-Lys-Lys-Arg-Lys-Val-Gly-Gly

Reference: HY-P3827
€0.00 (tax incl.)
Cys-Gly-Tyr-Gly-Pro-Lys-Lys-Lys-Arg-Lys-Val-Gly-Gly is a13-mer synthetic peptide containing seven amino acids homologous to SV40 T antigen. Cys-Gly-Tyr-Gly-Pro-Lys-Lys-Lys-Arg-Lys-Val-Gly-Gly is capable of inducing...
Fmoc-Asp-OtBu Fmoc-Asp-OtBu

Fmoc-Asp-OtBu

Reference: HY-W010959
€0.00 (tax incl.)
Fmoc-Asp-OtBu is an aspartic acid derivative.
H-Ile-Pro-Pro-OH hydrochloride H-Ile-Pro-Pro-OH hydrochloride

H-Ile-Pro-Pro-OH hydrochloride

Reference: HY-114424A
€0.00 (tax incl.)
H-Ile-Pro-Pro-OH hydrochloride, a milk-derived peptide, inhibits angiotensin-converting enzyme (ACE) with an IC50 of 5 μM. Antihypertensive tripeptides.
GLP-1(32-36)amide GLP-1(32-36)amide

GLP-1(32-36)amide

Reference: HY-P3102
€0.00 (tax incl.)
GLP-1(32-36)amide, a pentapeptide, derived from the C terminus of the glucoregulatory hormone GLP-1. GLP-1(32-36)amide could inhibit weight gain and modulate whole body glucose metabolism in diabetic mice.

Menu

Settings

Please sign in first.

Sign in