Category: Peptides

Reference: 27758-1
€0.00 (tax incl.)
An amine-reactive fluorescent probe; has been used, linked to adenosine A1 receptor ligands, as a fluorescent probe to quantify ligand-receptor binding; ex/em = 630/650 nm, respectively
Reference: 27758-5
€0.00 (tax incl.)
An amine-reactive fluorescent probe; has been used, linked to adenosine A1 receptor ligands, as a fluorescent probe to quantify ligand-receptor binding; ex/em = 630/650 nm, respectively
Reference: 300000-1
€0.00 (tax incl.)
The peptide is identical among human, mous, and rat optineurin, amino acids 559-575 (GEVLPDIDTLQIHVMDC). This blocking peptide can be used in conjunction with Cayman’s Optineurin (C-Term) Polyclonal Antibody (Catalog...
Reference: 300002-1
€0.00 (tax incl.)
Peptide Sequence: human optineurin amino acids 115-130 (KGKSERSSEDPTDDSR) · To be used in conjunction with Cayman’s optineurin (INT) polyclonal antibody (Catalog No. 100002) to block protein-antibody complex...
Reference: 300003-1
€0.00 (tax incl.)
Peptide Sequence: HIF-1α protein amino acids (SRNLLQGEELLRALDQVN) · To be used in conjunction with Cayman’s HIF-1α Polyclonal Antibody (Item No. 10006421) to block protein-antibody complex formation during...
Reference: 300011-1
€0.00 (tax incl.)
Peptide Sequence: human CD36 sequence amino acids 98-114 (AKENVTQDAEDNTVSF) · To be used in conjunction with Cayman’s CD36 polyclonal antibody (Catalog No. 100011) to block protein-antibody complex formation during...
Reference: 300012-1
€0.00 (tax incl.)
Peptide Sequence: amino acids 221-235 (VYGGKEARTEEMKWR) · To be used in conjunction with Cayman’s mPGE synthase-2 polyclonal antibody (Catalog No. 160145) to block protein-antibody complex formation during analysis...
Reference: 300013-1
€0.00 (tax incl.)
Peptide Sequence: human β-catenin amino acids 43-62 (APSLSGKGNPEEEDVDTSQV) · To be used in conjunction with Cayman’s β-catenin polyclonal antibody (Catalog No. 100029) to block protein-antibody complex formation...
Reference: 300014-1
€0.00 (tax incl.)
Peptide Sequence: human monoacylglycerol lipase blocking peptide amino acids 1-14 (MPEESSPRRTPQSI) · To be used in conjunction with Cayman’s Monoacylglycerol Lipase Polyclonal Antibody (Item No. 100035) to block...
Reference: 301550-200
€0.00 (tax incl.)
Peptide Sequence: human CB2 receptor sequence amino acids 20-33 (NPMKDYMILSGPQK)(6724) · To be used in conjunction with Cayman’s CB2 receptor polyclonal antibody (Catalog No. 101550) to block protein-antibody complex...
Reference: 301600-1
€0.00 (tax incl.)
Peptide Sequence: rat FAAH amino acids sequence 561-579 (CLRFMREVEQLMTPQKQPS)(9140) · To be used in conjunction with Cayman’s FAAH polyclonal antibody (Catalog No. 101600) to block protein-antibody complex formation...
Reference: 301640-1
€0.00 (tax incl.)
To be used in conjunction with Cayman’s DP1 Receptor Polyclonal Antibody (Catalog No. 101640) to block protein-antibody complex formation during immunochemical analysis of the DP1 receptor.
Reference: 301700-1
€0.00 (tax incl.)
Peptide Sequence: human PPARγ1 amino acids 82-101 (PASPPYYSEKTQLYNKPHEE; amino acids 110-129 of PPARγ2) · To be used in conjunction with Cayman’s PPARγ polyclonal antibody (Catalog No. 101700) to block...
Reference: 301710-1
€0.00 (tax incl.)
Peptide sequence: human PPARα amino acids 22-36 (PLSEEFLQEMGNIQE)(6160) · To be used in conjunction with Cayman’s PPARα polyclonal antibody (Item No. 101710) to block protein-antibody complex formation during analysis...
Reference: 301740-1
€0.00 (tax incl.)
Peptide Sequence: human EP1 receptor C-terminal amino acids 380-402 (GLTPSAWEASSLRSSRHSGLSHF)(3176) · To be used in conjunction with Cayman’s EP1 receptor polyclonal antibody (Catalog No. 101740) to block...
Reference: 301750-200
€0.00 (tax incl.)
Peptide Sequence: human EP2 receptor amino acids 335-358 (SLRTQDATQTSCSTQSDASKQADL)(3178) · To be used in conjunction with Cayman’s EP2 receptor polyclonal antibody (Catalog No. 101750) to block protein-antibody...
Reference: 301760-1
€0.00 (tax incl.)
Peptide Sequence: human EP3 receptor sequence amino acids 308-327 (NQTSVEHCKTHTEKQKECNF)(3180,1900) · To be used in conjunction with Cayman’s EP3 receptor polyclonal antibody (Catalog No. 101760) to block...
Reference: 301775-200
€0.00 (tax incl.)
Peptide Sequence: human EP4 receptor sequence amino acids 459-488 (GSGRAGPAPKGSSLQVTFPSETLNLSEKCI)(3164,3186) · To be used in conjunction with Cayman’s EP4 receptor polyclonal antibody (Catalog No. 101775) to block...
Reference: 301785-200
€0.00 (tax incl.)
Peptide Sequence: human RICK sequence amino acids 11-30 (PTIPYHKLADLRYLSRGASG) · To be used in conjunction with Cayman’s RICK polyclonal antibody (Catalog No. 160785) to block protein-antibody complex formation...
Reference: 320124-200
€0.00 (tax incl.)
Peptide sequence: human BLT2 receptor amino acids 325-338 (MELRTTPQLKVVGQ)(8743,8280,8525) · To be used in conjunction with Cayman’s BLT2 receptor polyclonal antibody (Catalog No. 120124) to block protein-antibody...
Reference: 320500-200
€0.00 (tax incl.)
Peptide Sequence: human CysLT1 receptor amino acids 318-337 (TYVPRKKASLPEKGEEICKV)(7174) · To be used in conjunction with Cayman’s CysLT1 receptor polyclonal antibody (Catalog No. 120500) to block protein-antibody...
Reference: 320550-1
€0.00 (tax incl.)
Peptide Sequence: human CysLT2 receptor amino acids 330-346 · To be used in conjunction with Cayman’s CysLT2 Receptor (C-Term) Polyclonal Antibody (Catalog No. 120550) to block protein-antibody complex formation...
Reference: 320560-200
€0.00 (tax incl.)
Peptide Sequence: human CysLT2 receptor N-terminal amino acids 1-18 (MERKFMSLQPSISVSEME)(8519,9059) · To be used in conjunction with Cayman’s CysLT2 receptor (N-term) polyclonal antibody (Catalog No. 120560) to block...
Reference: 360003-200
€0.00 (tax incl.)
Peptide Sequence: human lipocalin-type PGD synthase amino acids 30-41 (VQPNFQPDKFLG)(8449) · To be used in conjunction with Cayman’s lipocalin-type PGD synthase polyclonal antibody (Catalog No. 160003) to block...
Reference: 360013-200
€0.00 (tax incl.)
Peptide Sequence: Human hematopoietic type PGD synthase amino acids 30-41 (EDHRIEQADWPE)(8451) · To be used in conjunction with Cayman’s hematopoietic type PGD synthase polyclonal antibody (Catalog No. 160013) to...
Reference: 360070-1
€0.00 (tax incl.)
Peptide Sequence: human IP receptor amino acids · To be used in conjunction with Cayman’s IP receptor (mouse) polyclonal antibody (Item No. 160070) to block protein-antibody complex formation during immunochemical...
Reference: 360106-200
€0.00 (tax incl.)
Peptide Sequence: murine COX-2 amino acids 570-598 (DPQPTKTATINASASHSRLDDINPTVLIK)(1982) · To be used in conjunction with Cayman’s COX-2 (mouse) polyclonal antibodies (Item Nos. 160106, 160116, or 160126) to block...
Reference: 360107-200
€0.00 (tax incl.)
Peptide Sequence: human COX-2 amino acids 567-599 (SVPDPELIKTVTINASSSRSGLDDINPTVLLKE)(2) · To be used in conjunction with Cayman’s COX-2 (human) Polyclonal Antibody (Item No. 160107) or the COX-2 (human) monoclonal...
Reference: 360108-200
€0.00 (tax incl.)
Peptide Sequence: ovine COX-1 amino acids 272-282 (LMHYPRGIPPQ)(919) · To be used in conjunction with Cayman’s COX-1 (ovine) polyclonal antiserum (Catalog No. 160108) to block protein-antibody complex formation...
Reference: 360109-200
€0.00 (tax incl.)
Peptide Sequence: murine COX-1 amino acids 274-288 (LMRYPPGVPPERQMA)(300) · To be used in conjunction with Cayman’s COX-1 (mouse) polyclonal antibody (Item No. 160109) to block protein-antibody complex formation...
Reference: 360140-1
€0.00 (tax incl.)
Peptide Sequence: human amino acids 59-75 (CRSDPDVERSLRAHRND)(7229) · To be used in conjunction with Cayman’s microsomal PGE synthase-1 polyclonal antibody (Catalog No. 160140) to block protein-antibody complex...
Reference: 360150-1
€0.00 (tax incl.)
Peptide sequence: human cPGE synthase amino acids 58-67 (CIDPNDSKHK)(8691) · To be used in conjunction with Cayman’s cPGEsynthase polyclonal antibody (Catalog No. 160150) to block protein-antibody complex formation...
Reference: 360402-200
€0.00 (tax incl.)
Peptide Sequence: human and rat amino acids 130-149 (QHRRKELETRQKQYRWMEWN)(4212,4211,4210) · To be used in conjunction with Cayman’s 5-LO polyclonal antiserum (Catalog No. 160402) to block protein-antibody complex...
Reference: 360512-200
€0.00 (tax incl.)
Peptide sequence: mouse group V sPLA2 amino acids 79-94 (CAIRTQSYDYRYTNGL) · To be used in conjunction with Cayman’s sPLA2 (mouse type V) polyclonal antibody (Item No. 160512) to block protein-antibody complex...
Reference: 360600-1
€0.00 (tax incl.)
Peptide Sequence: human amino acids 260-269 (LGFQDSKFHQ).(5109,5148,5150) · To be used in conjunction with Cayman’s PAF receptor monoclonal antibody (Catalog No. 160600) to block protein-antibody complex formation...
Reference: 360603-200
€0.00 (tax incl.)
Peptide Sequence: human C-terminal amino acids 420-441 (TNINTTNQHIMLQNSSGIEKYN)(2618) · To be used in conjunction with Cayman’s PAF-AH polyclonal antiserum (Catalog No. 160603) to block protein-antibody complex...
Reference: 360615-200
€0.00 (tax incl.)
Peptide Sequence: amino acids 92-105 (AGVNNEKNWEKTLQ) from the human NAD+-dependent 15-hydroxy PGDH(387) · To be used in conjunction with Cayman’s 15-hydroxy PGDH polyclonal antibody (Catalog No. 160615) to block...
Reference: 360640-200
€0.00 (tax incl.)
Peptide Sequence: bovine amino acids 299-329 (LLKNPEALAAVRGELETVLLGAEQPISQMTT)(3477,3476,3478) · To be used in conjunction with Cayman’s PGIS polyclonal antibody (Catalog No. 160640) to block protein-antibody complex...
Reference: 360715-200
€0.00 (tax incl.)
Peptide Sequence: human amino acids 359-377 (TNPDCQEKLLREVDVFKEK)(50,4150) · To be used in conjunction with Cayman’s thromboxane synthase polyclonal antibody (Catalog No. 160715) to block protein-antibody complex...
Reference: 360745-200
€0.00 (tax incl.)
Peptide Sequence: human caspase-3 sequence amino acids 166-183 (TELDSGIETDSGVDDDMA)(8444) · To be used in conjunction with Cayman’s Caspase-3 (human) Polyclonal Antibody (Catalog No. 160745) to block protein-antibody...
Reference: 360773-1
€0.00 (tax incl.)
Peptide Sequence: human AIF amino acids 151-180 (RARDPGARVLIVSEDPELPYMRPPLSKELW) · To be used in conjunction with Cayman’s AIF polyclonal antibody (Catalog No. 160773) to block protein-antibody complex formation...
Reference: 360780-200
€0.00 (tax incl.)
Peptide Sequence: human Apaf-1 amino acids 12-28 (HREALEKDIKTSYIMDHC); the sequence of the peptide is identical between human and mouse.(6894,6873) · To be used in conjunction with Cayman’s Apaf-1 polyclonal antibody...
Reference: 360871-200
€0.00 (tax incl.)
Peptide Sequence: human nNOS amino acids 1422-1433 (ESKKDTDEVFSS)(1280,4153) · To be used in conjunction with Cayman’s nNOS polyclonal antibody (Catalog No. 160870) to block protein-antibody complex formation during...
Reference: 360881-200
€0.00 (tax incl.)
Peptide Sequence: human eNOS amino acids 1186-1203 (RGAVPWAFDPPGSDTNS) · To be used in conjunction with Cayman’s eNOS polyclonal antiserum (Item No. 160880) to block protein-antibody complex formation during analysis...
Reference: 360895-200
€0.00 (tax incl.)
Peptide sequences: human guanylate cyclase α subunit amino acids 418-436 (EQARAQDGLKKRLGKLKAT) · To be used in conjunction with Cayman’s guanylate cyclase α subunit polyclonal antibody (Catalog No. 160895) to block...
Reference: 360897-200
€0.00 (tax incl.)
Peptide Sequence: soluble rat guanylate cyclase β1 subunit, amino acids 188-207 (EDFYEDLDRFEENGTQDSR; last D=E in human and bovine)(3531,4654,3535) · To be used in conjunction with Cayman’s guanylate cyclase β1...
Reference: GTX00459
€0.00 (tax incl.)
The protein encoded by this gene is a member of the tumor necrosis factor (TNF) ligand family. This protein is a ligand for TNFRSF17/BCMA, a member of the TNF receptor family. This protein and its receptor are both...
Reference: GTX10079-PEP
€0.00 (tax incl.)
The protein encoded by this gene is a member of the syntrophin family. Syntrophins are cytoplasmic peripheral membrane proteins that typically contain 2 pleckstrin homology (PH) domains, a PDZ domain that bisects the...
Reference: GTX10099-PEP
€0.00 (tax incl.)
This gene belongs to a group of vacuolar protein sorting (VPS) genes. The encoded protein is a component of a large multimeric complex, termed the retromer complex, involved in retrograde transport of proteins from...
Reference: GTX10133-PEP
€0.00 (tax incl.)
This gene encodes a protein involved in endosomal sorting of cell surface receptors via a multivesicular body/late endosome pathway. The encoded protein is one of the three subunits of the ESCRT-I complex (endosomal...
Reference: GTX10142-PEP
€0.00 (tax incl.)
The pattern of cellular proliferation and differentiation that leads to normal development of embryonic structures often depends upon the localized production of secreted protein signals. Cells surrounding the source...
Reference: GTX10145-PEP
€0.00 (tax incl.)
The protein encoded by this gene may play a role in intracellular vesicle trafficking. It interacts with Syntaxin 13 which mediates intracellular membrane fusion. Several alternatively spliced transcript variants of...
Reference: GTX10151-PEP
€0.00 (tax incl.)
This gene encodes a member of the oxysterol-binding protein (OSBP) family, a group of intracellular lipid receptors. Most members contain an N-terminal pleckstrin homology domain and a highly conserved C-terminal...
Reference: GTX10152-PEP
€0.00 (tax incl.)
Rho GTPases are GTP binding proteins that regulate a wide spectrum of cellular functions. These cellular processes include cytoskeletal rearrangements, gene transcription, cell growth and motility. Activation of Rho...
Reference: GTX10160-PEP
€0.00 (tax incl.)
This gene belongs to a group of vacuolar protein sorting (VPS) genes that, when functionally impaired, disrupt the efficient delivery of vacuolar hydrolases. The protein encoded by this gene is a component of a large...
Reference: GTX10162-PEP
€0.00 (tax incl.)
The product of this gene is a mitogen induced GTPase activating protein (GAP). It exhibits a specific GAP activity for Ras-related regulatory proteins Rap1 and Rap2, but not for Ran or other small GTPases. This...
Reference: GTX10179-PEP
€0.00 (tax incl.)
This gene encodes a type I cell-surface receptor for the TGF-beta superfamily of ligands. It shares with other type I receptors a high degree of similarity in serine-threonine kinase subdomains, a glycine- and...
Reference: GTX10180-PEP
€0.00 (tax incl.)
The protein encoded by this gene is a molecular chaperone that is a member of the chaperonin containing TCP1 complex (CCT), also known as the TCP1 ring complex (TRiC). This complex consists of two identical stacked...
Reference: GTX10256-PEP
€0.00 (tax incl.)
This gene encodes a protein that binds the cancer-testis antigen Synovial Sarcoma X breakpoint 2 protein. The encoded protein may regulate the activity of Synovial Sarcoma X breakpoint 2 protein in malignant cells....
Reference: GTX10261-PEP
€0.00 (tax incl.)
DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure, such...
Reference: GTX10265-PEP
€0.00 (tax incl.)
This gene encodes a member of a family of lipid-binding proteins that transfer molecules of phosphatidylinositol or phosphatidylcholine between membrane surfaces. The protein is implicated in phospholipase C signaling...
Reference: GTX10632-PEP
€0.00 (tax incl.)
This gene encodes a member of the interferon regulatory transcription factor (IRF) family. The encoded protein is found in an inactive cytoplasmic form that upon serine/threonine phosphorylation forms a complex with...
Reference: GTX10924-PEP
€0.00 (tax incl.)
This gene encodes a member of the B-cell receptor associated protein 31 superfamily. The encoded protein is a multi-pass transmembrane protein of the endoplasmic reticulum that is involved in the anterograde transport...
Reference: GTX10925-PEP
€0.00 (tax incl.)
This gene encodes a member of the interferon regulatory transcription factor (IRF) family. Family members share a highly-conserved N-terminal helix-turn-helix DNA-binding domain and a less conserved C-terminal...
Reference: GTX11254
€0.00 (tax incl.)
MAD2L2 is a component of the mitotic spindle assembly checkpoint that prevents the onset of anaphase until all chromosomes are properly aligned at the metaphase plate. MAD2L2 is a homolog of MAD2L1.
Reference: GTX11799-PEP
€0.00 (tax incl.)
This gene encodes a major cytoplasmic protein which is the only known constituent common to submembranous plaques of both desmosomes and intermediate junctions. This protein forms distinct complexes with cadherins and...
Reference: GTX11800-PEP
€0.00 (tax incl.)
The protein encoded by this gene acts as a homotetramer to catalyze diacetyl reductase and L-xylulose reductase reactions. The encoded protein may play a role in the uronate cycle of glucose metabolism and in the...
Reference: GTX11801-PEP
€0.00 (tax incl.)
This gene encodes an E26 transformation-specific related transcription factor. The encoded protein is primarily expressed in lymphoid cells and acts as both an enhancer and a repressor to regulate transcription of...
Reference: GTX11802-PEP
€0.00 (tax incl.)
This gene encodes a member of the aldo/keto reductase superfamily, which consists of more than 4 known enzymes and proteins. This member, also known as aldehyde reductase, is involved in the reduction of biogenic and...
Reference: GTX11803-PEP
€0.00 (tax incl.)
This gene encodes one of four subunits of the splicing factor 3B. The protein encoded by this gene cross-links to a region in the pre-mRNA immediately upstream of the branchpoint sequence in pre-mRNA in the...
Reference: GTX11805-PEP
€0.00 (tax incl.)
This gene encodes a protein with similarity to follistatin, an activin-binding protein. It contains an FS module, a follistatin-like sequence containing 1 conserved cysteine residues. This gene product is thought to...
Reference: GTX11806-PEP
€0.00 (tax incl.)
This gene encodes the largest subunit of dynactin, a macromolecular complex consisting of 1 subunits ranging in size from 22 to 15 kD. Dynactin binds to both microtubules and cytoplasmic dynein. Dynactin is involved...
Reference: GTX13493-PEP
€0.00 (tax incl.)
Caveolae are small domains on the inner cell membrane involved in vesicular trafficking and signal transduction. FLOT1 encodes a caveolae-associated, integral membrane protein. The function of flotillin 1 has not been...
Reference: GTX13519
€0.00 (tax incl.)
This protein belongs to the basic helix-loop-helix (BHLH) family of transcription factors. It activates E-box dependent transcription along with E47.
Reference: GTX13535-PEP
€0.00 (tax incl.)
This gene encodes a member of the ADAM (a disintegrin and metalloprotease domain) family. Members of this family are membrane-anchored proteins structurally related to snake venom disintegrins, and have been...
Reference: GTX13573-PEP
€0.00 (tax incl.)
This gene encodes a transcriptional regulator that forms nuclear bodies and interacts with the transcriptional coactivator CREB binding protein. The encoded protein plays an important role in immunity by regulating...
Reference: GTX13574-PEP
€0.00 (tax incl.)
This gene encodes a member of the family of pyridine nucleotide oxidoreductases. This protein reduces thioredoxins as well as other substrates, and plays a role in selenium metabolism and protection against oxidative...
Reference: GTX13581-PEP
€0.00 (tax incl.)
The protein encoded by this gene is a member of an epithelium-specific subclass of the Ets transcritpion factor family. In addition to its role in regulating the later stages of terminal differentiation of...
Reference: GTX13611-PEP
€0.00 (tax incl.)
This gene encodes a member of the paired box (PAX) family of transcription factors. Members of this gene family typically encode proteins that contain a paired box domain, an octapeptide, and a paired-type...
Reference: GTX13615-PEP
€0.00 (tax incl.)
MAD2L1 is a component of the mitotic spindle assembly checkpoint that prevents the onset of anaphase until all chromosomes are properly aligned at the metaphase plate. MAD2L1 is related to the MAD2L2 gene located on...
Reference: GTX13618-PEP
€0.00 (tax incl.)
Expression of this gene is affected by vitamin A. The encoded protein of this gene may be associated with the cytoskeleton. A similar protein in rats may play a role in the regulation of cell differentiation. The rat...
Reference: GTX13677-PEP
€0.00 (tax incl.)
This gene encodes the medium-chain specific (C4 to C12 straight chain) acyl-Coenzyme A dehydrogenase. The homotetramer enzyme catalyzes the initial step of the mitochondrial fatty acid beta-oxidation pathway. Defects...
Reference: GTX13712-PEP
€0.00 (tax incl.)
Proteins that contain a SET domain, such as SETDB2, modulate gene expression epigenetically through histone H3 (see MIM 61128) methylation. SETDB2 is likely a histone H3 methyltransferase, as it contains both the...
Reference: GTX13796-PEP
€0.00 (tax incl.)
This gene encodes a 42.6 kD subunit of dynactin, a macromolecular complex consisting of 1-11 subunits ranging in size from 22 to 15 kD. Dynactin binds to both microtubules and cytoplasmic dynein. It is involved in a...
Reference: GTX13820-PEP
€0.00 (tax incl.)
This gene encodes a protein-disulfide isomerase. Its expression is induced by hypoxia and its role may be to protect hypoxic cells from apoptosis. Alternative splicing results in multiple transcript variants....
Reference: GTX14676-PEP
€0.00 (tax incl.)
The protein encoded by this gene is involved in the formation of the pre-replication complex that is necessary for DNA replication. The encoded protein can bind geminin, which prevents replication and may function to...
Reference: GTX14708-PEP
€0.00 (tax incl.)
This gene encodes a member of the ribosomal S6 kinase family of serine/threonine kinases. The encoded protein responds to mTOR (mammalian target of rapamycin) signaling to promote protein synthesis, cell growth, and...
Reference: GTX14747-PEP
€0.00 (tax incl.)
The protein encoded by this gene was first identified by its ability to bind the adenovirus E1A protein. The protein localizes to the nucleus. It functions as a transcriptional repressor, and expression of E1A...
Reference: GTX14749-PEP
€0.00 (tax incl.)
The protein encoded by this gene is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. The protein...
Reference: GTX14751-PEP
€0.00 (tax incl.)
Polycomb group (PcG) of proteins form the multiprotein complexes that are important for the transcription repression of various genes involved in development and cell proliferation. The protein encoded by this gene is...
Reference: GTX14759-PEP
€0.00 (tax incl.)
The protein encoded by this gene is highly expressed in peripheral blood of patients with atopic dermatitis (AD), compared to normal individuals. It may play a role in regulating the resistance to apoptosis that is...
Reference: GTX14787-PEP
€0.00 (tax incl.)
This gene encodes a member of the WD repeat protein family. WD repeats are minimally conserved regions of approximately 4 amino acids typically bracketed by gly-his and trp-asp (GH-WD), which may facilitate formation...
Reference: GTX15351
€0.00 (tax incl.)
Angiotensin-converting enzyme 2 (ACE2) plays a central role in vascular, renal, and myocardial physiology. In contrast to its homolog ACE, ACE2 expression is restricted to heart, kidney, and testis. Recently ACE2 has...

Menu

Settings