Category: Proteins & Peptides

Filter By
Brand: Arigo Biolaboratoires Brand: Boster Bio Brand: Cayman Chemical Clear all
PPARγ FL (human, recombinant from E. coli) PPARγ FL (human, recombinant from E. coli)

PPARγ FL (human, recombinant from E. coli)

Reference: 61700-25
€0.00 (tax incl.)
Source: human recombinant N-terminal His-tagged protein expressed in E. coli · MW: ~60 kDa • PPARs are members of the nuclear receptor family of ligand activated transcription factors that heterodimerize with...
PPARγ FL (human, recombinant from E. coli) PPARγ FL (human, recombinant from E. coli)

PPARγ FL (human, recombinant from E. coli)

Reference: 61700-50
€0.00 (tax incl.)
Source: human recombinant N-terminal His-tagged protein expressed in E. coli · MW: ~60 kDa • PPARs are members of the nuclear receptor family of ligand activated transcription factors that heterodimerize with...
27-alkyne Cholesterol 27-alkyne Cholesterol

27-alkyne Cholesterol

Reference: 24319-100
€0.00 (tax incl.)
An alkyne derivative of cholesterol for click chemistry; has been used to track cholesterol metabolism and localization
27-alkyne Cholesterol 27-alkyne Cholesterol

27-alkyne Cholesterol

Reference: 24319-250
€0.00 (tax incl.)
An alkyne derivative of cholesterol for click chemistry; has been used to track cholesterol metabolism and localization
27-alkyne Cholesterol 27-alkyne Cholesterol

27-alkyne Cholesterol

Reference: 24319-500
€0.00 (tax incl.)
An alkyne derivative of cholesterol for click chemistry; has been used to track cholesterol metabolism and localization
BODIPY-Cholesterol BODIPY-Cholesterol

BODIPY-Cholesterol

Reference: 24618-1
€0.00 (tax incl.)
A fluorescently-tagged cholesterol; co-localizes with dehydroergosterol in HeLa cells and is trafficked from the plasma membrane to the endocytic recycling compartment in BHK cells; ex/em = 480/508 nm, respectively;...
BODIPY-Cholesterol BODIPY-Cholesterol

BODIPY-Cholesterol

Reference: 24618-10
€0.00 (tax incl.)
A fluorescently-tagged cholesterol; co-localizes with dehydroergosterol in HeLa cells and is trafficked from the plasma membrane to the endocytic recycling compartment in BHK cells; ex/em = 480/508 nm, respectively;...
BODIPY-Cholesterol BODIPY-Cholesterol

BODIPY-Cholesterol

Reference: 24618-5
€0.00 (tax incl.)
A fluorescently-tagged cholesterol; co-localizes with dehydroergosterol in HeLa cells and is trafficked from the plasma membrane to the endocytic recycling compartment in BHK cells; ex/em = 480/508 nm, respectively;...
BODIPY-Cholesterol BODIPY-Cholesterol

BODIPY-Cholesterol

Reference: 24618-500
€0.00 (tax incl.)
A fluorescently-tagged cholesterol; co-localizes with dehydroergosterol in HeLa cells and is trafficked from the plasma membrane to the endocytic recycling compartment in BHK cells; ex/em = 480/508 nm, respectively;...
SureLight® 488 NHS ester SureLight® 488 NHS ester

SureLight® 488 NHS ester

Reference: 27091-1
€0.00 (tax incl.)
SureLight® 488 is a bright green fluorescent dye with excitation suited to the 488 nm laser line, fluorescent microscopy, and flow cytometry. The NHS ester version is an efficient amine reactive probe that can be used...
SureLight® 488 NHS ester SureLight® 488 NHS ester

SureLight® 488 NHS ester

Reference: 27091-100
€0.00 (tax incl.)
SureLight® 488 is a bright green fluorescent dye with excitation suited to the 488 nm laser line, fluorescent microscopy, and flow cytometry. The NHS ester version is an efficient amine reactive probe that can be used...
N-α-Benzoyl-L-Arginine ethyl ester (hydrochloride) N-α-Benzoyl-L-Arginine ethyl ester (hydrochloride)

N-α-Benzoyl-L-Arginine ethyl ester (hydrochloride)

Reference: 27183-10
€0.00 (tax incl.)
A nonpeptide substrate of proteases and deiminases; has been used as a substrate for the relative quantification of trypsin activity; has also been used as a substrate for the activity of subtilisins, kallikreins, and...
N-α-Benzoyl-L-Arginine ethyl ester (hydrochloride) N-α-Benzoyl-L-Arginine ethyl ester (hydrochloride)

N-α-Benzoyl-L-Arginine ethyl ester (hydrochloride)

Reference: 27183-5
€0.00 (tax incl.)
A nonpeptide substrate of proteases and deiminases; has been used as a substrate for the relative quantification of trypsin activity; has also been used as a substrate for the activity of subtilisins, kallikreins, and...
N-α-Benzoyl-L-Arginine ethyl ester (hydrochloride) N-α-Benzoyl-L-Arginine ethyl ester (hydrochloride)

N-α-Benzoyl-L-Arginine ethyl ester (hydrochloride)

Reference: 27183-50
€0.00 (tax incl.)
A nonpeptide substrate of proteases and deiminases; has been used as a substrate for the relative quantification of trypsin activity; has also been used as a substrate for the activity of subtilisins, kallikreins, and...
Biotin-Amyloid-β (1-40) Peptide (trifluoroacetate salt) Biotin-Amyloid-β (1-40) Peptide (trifluoroacetate salt)

Biotin-Amyloid-β (1-40) Peptide (trifluoroacetate salt)

Reference: 27411-500
€0.00 (tax incl.)
An affinity probe for Aβ40 binding partners; has been used to characterize Aβ40 distribution amongst the lipoprotein fractions and identify Aβ40 interaction partners in human plasma,
Histone H1-derived Peptide (trifluoroacetate salt) Histone H1-derived Peptide (trifluoroacetate salt)

Histone H1-derived Peptide (trifluoroacetate salt)

Reference: 27439-1
€0.00 (tax incl.)
A peptide substrate for CRK3/CYC6; phosphorylated by CRK3/CYC6 and has been used in high-throughput screening assays for the identification of CRK3/CYC6 inhibitors
BODIPY 630/650X succinimide ester BODIPY 630/650X succinimide ester

BODIPY 630/650X succinimide ester

Reference: 27758-1
€0.00 (tax incl.)
An amine-reactive fluorescent probe; has been used, linked to adenosine A1 receptor ligands, as a fluorescent probe to quantify ligand-receptor binding; ex/em = 630/650 nm, respectively
BODIPY 630/650X succinimide ester BODIPY 630/650X succinimide ester

BODIPY 630/650X succinimide ester

Reference: 27758-5
€0.00 (tax incl.)
An amine-reactive fluorescent probe; has been used, linked to adenosine A1 receptor ligands, as a fluorescent probe to quantify ligand-receptor binding; ex/em = 630/650 nm, respectively
Optineurin (C-Term) Blocking Peptide Optineurin (C-Term) Blocking Peptide

Optineurin (C-Term) Blocking Peptide

Reference: 300000-1
€0.00 (tax incl.)
The peptide is identical among human, mous, and rat optineurin, amino acids 559-575 (GEVLPDIDTLQIHVMDC). This blocking peptide can be used in conjunction with Cayman’s Optineurin (C-Term) Polyclonal Antibody (Catalog...
Optineurin (INT) Blocking Peptide Optineurin (INT) Blocking Peptide

Optineurin (INT) Blocking Peptide

Reference: 300002-1
€0.00 (tax incl.)
Peptide Sequence: human optineurin amino acids 115-130 (KGKSERSSEDPTDDSR) · To be used in conjunction with Cayman’s optineurin (INT) polyclonal antibody (Catalog No. 100002) to block protein-antibody complex...
HIF-1α (C-Term) Blocking Peptide HIF-1α (C-Term) Blocking Peptide

HIF-1α (C-Term) Blocking Peptide

Reference: 300003-1
€0.00 (tax incl.)
Peptide Sequence: HIF-1α protein amino acids (SRNLLQGEELLRALDQVN) · To be used in conjunction with Cayman’s HIF-1α Polyclonal Antibody (Item No. 10006421) to block protein-antibody complex formation during...
CD36 Blocking Peptide CD36 Blocking Peptide

CD36 Blocking Peptide

Reference: 300011-1
€0.00 (tax incl.)
Peptide Sequence: human CD36 sequence amino acids 98-114 (AKENVTQDAEDNTVSF) · To be used in conjunction with Cayman’s CD36 polyclonal antibody (Catalog No. 100011) to block protein-antibody complex formation during...
Prostaglandin E Synthase-2 (microsomal) Blocking Peptide Prostaglandin E Synthase-2 (microsomal) Blocking Peptide

Prostaglandin E Synthase-2 (microsomal) Blocking Peptide

Reference: 300012-1
€0.00 (tax incl.)
Peptide Sequence: amino acids 221-235 (VYGGKEARTEEMKWR) · To be used in conjunction with Cayman’s mPGE synthase-2 polyclonal antibody (Catalog No. 160145) to block protein-antibody complex formation during analysis...
β-Catenin Blocking Peptide β-Catenin Blocking Peptide

β-Catenin Blocking Peptide

Reference: 300013-1
€0.00 (tax incl.)
Peptide Sequence: human β-catenin amino acids 43-62 (APSLSGKGNPEEEDVDTSQV) · To be used in conjunction with Cayman’s β-catenin polyclonal antibody (Catalog No. 100029) to block protein-antibody complex formation...
Monoacylglycerol Lipase Blocking Peptide Monoacylglycerol Lipase Blocking Peptide

Monoacylglycerol Lipase Blocking Peptide

Reference: 300014-1
€0.00 (tax incl.)
Peptide Sequence: human monoacylglycerol lipase blocking peptide amino acids 1-14 (MPEESSPRRTPQSI) · To be used in conjunction with Cayman’s Monoacylglycerol Lipase Polyclonal Antibody (Item No. 100035) to block...
CB2 Receptor Blocking Peptide CB2 Receptor Blocking Peptide

CB2 Receptor Blocking Peptide

Reference: 301550-200
€0.00 (tax incl.)
Peptide Sequence: human CB2 receptor sequence amino acids 20-33 (NPMKDYMILSGPQK)(6724) · To be used in conjunction with Cayman’s CB2 receptor polyclonal antibody (Catalog No. 101550) to block protein-antibody complex...
Fatty Acid Amide Hydrolase Blocking Peptide Fatty Acid Amide Hydrolase Blocking Peptide

Fatty Acid Amide Hydrolase Blocking Peptide

Reference: 301600-1
€0.00 (tax incl.)
Peptide Sequence: rat FAAH amino acids sequence 561-579 (CLRFMREVEQLMTPQKQPS)(9140) · To be used in conjunction with Cayman’s FAAH polyclonal antibody (Catalog No. 101600) to block protein-antibody complex formation...
DP1 Receptor Blocking Peptide DP1 Receptor Blocking Peptide

DP1 Receptor Blocking Peptide

Reference: 301640-1
€0.00 (tax incl.)
To be used in conjunction with Cayman’s DP1 Receptor Polyclonal Antibody (Catalog No. 101640) to block protein-antibody complex formation during immunochemical analysis of the DP1 receptor.
PPARγ Blocking Peptide PPARγ Blocking Peptide

PPARγ Blocking Peptide

Reference: 301700-1
€0.00 (tax incl.)
Peptide Sequence: human PPARγ1 amino acids 82-101 (PASPPYYSEKTQLYNKPHEE; amino acids 110-129 of PPARγ2) · To be used in conjunction with Cayman’s PPARγ polyclonal antibody (Catalog No. 101700) to block...
PPARα Blocking Peptide PPARα Blocking Peptide

PPARα Blocking Peptide

Reference: 301710-1
€0.00 (tax incl.)
Peptide sequence: human PPARα amino acids 22-36 (PLSEEFLQEMGNIQE)(6160) · To be used in conjunction with Cayman’s PPARα polyclonal antibody (Item No. 101710) to block protein-antibody complex formation during analysis...
EP1 Receptor Blocking Peptide EP1 Receptor Blocking Peptide

EP1 Receptor Blocking Peptide

Reference: 301740-1
€0.00 (tax incl.)
Peptide Sequence: human EP1 receptor C-terminal amino acids 380-402 (GLTPSAWEASSLRSSRHSGLSHF)(3176) · To be used in conjunction with Cayman’s EP1 receptor polyclonal antibody (Catalog No. 101740) to block...
EP2 Receptor Blocking Peptide EP2 Receptor Blocking Peptide

EP2 Receptor Blocking Peptide

Reference: 301750-200
€0.00 (tax incl.)
Peptide Sequence: human EP2 receptor amino acids 335-358 (SLRTQDATQTSCSTQSDASKQADL)(3178) · To be used in conjunction with Cayman’s EP2 receptor polyclonal antibody (Catalog No. 101750) to block protein-antibody...
EP3 Receptor Blocking Peptide EP3 Receptor Blocking Peptide

EP3 Receptor Blocking Peptide

Reference: 301760-1
€0.00 (tax incl.)
Peptide Sequence: human EP3 receptor sequence amino acids 308-327 (NQTSVEHCKTHTEKQKECNF)(3180,1900) · To be used in conjunction with Cayman’s EP3 receptor polyclonal antibody (Catalog No. 101760) to block...
EP4 Receptor (C-Term) Blocking Peptide EP4 Receptor (C-Term) Blocking Peptide

EP4 Receptor (C-Term) Blocking Peptide

Reference: 301775-200
€0.00 (tax incl.)
Peptide Sequence: human EP4 receptor sequence amino acids 459-488 (GSGRAGPAPKGSSLQVTFPSETLNLSEKCI)(3164,3186) · To be used in conjunction with Cayman’s EP4 receptor polyclonal antibody (Catalog No. 101775) to block...
RICK Blocking Peptide RICK Blocking Peptide

RICK Blocking Peptide

Reference: 301785-200
€0.00 (tax incl.)
Peptide Sequence: human RICK sequence amino acids 11-30 (PTIPYHKLADLRYLSRGASG) · To be used in conjunction with Cayman’s RICK polyclonal antibody (Catalog No. 160785) to block protein-antibody complex formation...
BLT2 Receptor Blocking Peptide BLT2 Receptor Blocking Peptide

BLT2 Receptor Blocking Peptide

Reference: 320124-200
€0.00 (tax incl.)
Peptide sequence: human BLT2 receptor amino acids 325-338 (MELRTTPQLKVVGQ)(8743,8280,8525) · To be used in conjunction with Cayman’s BLT2 receptor polyclonal antibody (Catalog No. 120124) to block protein-antibody...
CysLT1 Receptor Blocking Peptide CysLT1 Receptor Blocking Peptide

CysLT1 Receptor Blocking Peptide

Reference: 320500-200
€0.00 (tax incl.)
Peptide Sequence: human CysLT1 receptor amino acids 318-337 (TYVPRKKASLPEKGEEICKV)(7174) · To be used in conjunction with Cayman’s CysLT1 receptor polyclonal antibody (Catalog No. 120500) to block protein-antibody...
CysLT2 Receptor (C-Term) Blocking Peptide CysLT2 Receptor (C-Term) Blocking Peptide

CysLT2 Receptor (C-Term) Blocking Peptide

Reference: 320550-1
€0.00 (tax incl.)
Peptide Sequence: human CysLT2 receptor amino acids 330-346 · To be used in conjunction with Cayman’s CysLT2 Receptor (C-Term) Polyclonal Antibody (Catalog No. 120550) to block protein-antibody complex formation...
CysLT2 Receptor (N-Term) Blocking Peptide CysLT2 Receptor (N-Term) Blocking Peptide

CysLT2 Receptor (N-Term) Blocking Peptide

Reference: 320560-200
€0.00 (tax incl.)
Peptide Sequence: human CysLT2 receptor N-terminal amino acids 1-18 (MERKFMSLQPSISVSEME)(8519,9059) · To be used in conjunction with Cayman’s CysLT2 receptor (N-term) polyclonal antibody (Catalog No. 120560) to block...
Prostaglandin D Synthase (lipocalin-type) Blocking Peptide Prostaglandin D Synthase (lipocalin-type) Blocking Peptide

Prostaglandin D Synthase (lipocalin-type) Blocking Peptide

Reference: 360003-200
€0.00 (tax incl.)
Peptide Sequence: human lipocalin-type PGD synthase amino acids 30-41 (VQPNFQPDKFLG)(8449) · To be used in conjunction with Cayman’s lipocalin-type PGD synthase polyclonal antibody (Catalog No. 160003) to block...
Prostaglandin D Synthase (hematopoietic-type) Blocking Peptide Prostaglandin D Synthase (hematopoietic-type) Blocking Peptide

Prostaglandin D Synthase (hematopoietic-type) Blocking Peptide

Reference: 360013-200
€0.00 (tax incl.)
Peptide Sequence: Human hematopoietic type PGD synthase amino acids 30-41 (EDHRIEQADWPE)(8451) · To be used in conjunction with Cayman’s hematopoietic type PGD synthase polyclonal antibody (Catalog No. 160013) to...
IP Receptor (mouse) Blocking Peptide IP Receptor (mouse) Blocking Peptide

IP Receptor (mouse) Blocking Peptide

Reference: 360070-1
€0.00 (tax incl.)
Peptide Sequence: human IP receptor amino acids · To be used in conjunction with Cayman’s IP receptor (mouse) polyclonal antibody (Item No. 160070) to block protein-antibody complex formation during immunochemical...
COX-2 (mouse) Blocking Peptide COX-2 (mouse) Blocking Peptide

COX-2 (mouse) Blocking Peptide

Reference: 360106-200
€0.00 (tax incl.)
Peptide Sequence: murine COX-2 amino acids 570-598 (DPQPTKTATINASASHSRLDDINPTVLIK)(1982) · To be used in conjunction with Cayman’s COX-2 (mouse) polyclonal antibodies (Item Nos. 160106, 160116, or 160126) to block...
COX-2 (human) Blocking Peptide COX-2 (human) Blocking Peptide

COX-2 (human) Blocking Peptide

Reference: 360107-200
€0.00 (tax incl.)
Peptide Sequence: human COX-2 amino acids 567-599 (SVPDPELIKTVTINASSSRSGLDDINPTVLLKE)(2) · To be used in conjunction with Cayman’s COX-2 (human) Polyclonal Antibody (Item No. 160107) or the COX-2 (human) monoclonal...
COX-1 (ovine) Blocking Peptide COX-1 (ovine) Blocking Peptide

COX-1 (ovine) Blocking Peptide

Reference: 360108-200
€0.00 (tax incl.)
Peptide Sequence: ovine COX-1 amino acids 272-282 (LMHYPRGIPPQ)(919) · To be used in conjunction with Cayman’s COX-1 (ovine) polyclonal antiserum (Catalog No. 160108) to block protein-antibody complex formation...
COX-1 (mouse) Blocking Peptide COX-1 (mouse) Blocking Peptide

COX-1 (mouse) Blocking Peptide

Reference: 360109-200
€0.00 (tax incl.)
Peptide Sequence: murine COX-1 amino acids 274-288 (LMRYPPGVPPERQMA)(300) · To be used in conjunction with Cayman’s COX-1 (mouse) polyclonal antibody (Item No. 160109) to block protein-antibody complex formation...
Prostaglandin E Synthase-1 (microsomal) Blocking Peptide Prostaglandin E Synthase-1 (microsomal) Blocking Peptide

Prostaglandin E Synthase-1 (microsomal) Blocking Peptide

Reference: 360140-1
€0.00 (tax incl.)
Peptide Sequence: human amino acids 59-75 (CRSDPDVERSLRAHRND)(7229) · To be used in conjunction with Cayman’s microsomal PGE synthase-1 polyclonal antibody (Catalog No. 160140) to block protein-antibody complex...
Prostaglandin E Synthase (cytosolic) Blocking Peptide Prostaglandin E Synthase (cytosolic) Blocking Peptide

Prostaglandin E Synthase (cytosolic) Blocking Peptide

Reference: 360150-1
€0.00 (tax incl.)
Peptide sequence: human cPGE synthase amino acids 58-67 (CIDPNDSKHK)(8691) · To be used in conjunction with Cayman’s cPGEsynthase polyclonal antibody (Catalog No. 160150) to block protein-antibody complex formation...
5-Lipoxygenase Blocking Peptide 5-Lipoxygenase Blocking Peptide

5-Lipoxygenase Blocking Peptide

Reference: 360402-200
€0.00 (tax incl.)
Peptide Sequence: human and rat amino acids 130-149 (QHRRKELETRQKQYRWMEWN)(4212,4211,4210) · To be used in conjunction with Cayman’s 5-LO polyclonal antiserum (Catalog No. 160402) to block protein-antibody complex...
sPLA2 (mouse Type V) Blocking Peptide sPLA2 (mouse Type V) Blocking Peptide

sPLA2 (mouse Type V) Blocking Peptide

Reference: 360512-200
€0.00 (tax incl.)
Peptide sequence: mouse group V sPLA2 amino acids 79-94 (CAIRTQSYDYRYTNGL) · To be used in conjunction with Cayman’s sPLA2 (mouse type V) polyclonal antibody (Item No. 160512) to block protein-antibody complex...
PAF Receptor Blocking Peptide (Monoclonal) PAF Receptor Blocking Peptide (Monoclonal)

PAF Receptor Blocking Peptide (Monoclonal)

Reference: 360600-1
€0.00 (tax incl.)
Peptide Sequence: human amino acids 260-269 (LGFQDSKFHQ).(5109,5148,5150) · To be used in conjunction with Cayman’s PAF receptor monoclonal antibody (Catalog No. 160600) to block protein-antibody complex formation...
PAF Acetylhydrolase Blocking Peptide PAF Acetylhydrolase Blocking Peptide

PAF Acetylhydrolase Blocking Peptide

Reference: 360603-200
€0.00 (tax incl.)
Peptide Sequence: human C-terminal amino acids 420-441 (TNINTTNQHIMLQNSSGIEKYN)(2618) · To be used in conjunction with Cayman’s PAF-AH polyclonal antiserum (Catalog No. 160603) to block protein-antibody complex...
15-hydroxy Prostaglandin Dehydrogenase Blocking Peptide 15-hydroxy Prostaglandin Dehydrogenase Blocking Peptide

15-hydroxy Prostaglandin Dehydrogenase Blocking Peptide

Reference: 360615-200
€0.00 (tax incl.)
Peptide Sequence: amino acids 92-105 (AGVNNEKNWEKTLQ) from the human NAD+-dependent 15-hydroxy PGDH(387) · To be used in conjunction with Cayman’s 15-hydroxy PGDH polyclonal antibody (Catalog No. 160615) to block...
Prostaglandin I Synthase Blocking Peptide Prostaglandin I Synthase Blocking Peptide

Prostaglandin I Synthase Blocking Peptide

Reference: 360640-200
€0.00 (tax incl.)
Peptide Sequence: bovine amino acids 299-329 (LLKNPEALAAVRGELETVLLGAEQPISQMTT)(3477,3476,3478) · To be used in conjunction with Cayman’s PGIS polyclonal antibody (Catalog No. 160640) to block protein-antibody complex...
Thromboxane Synthase Blocking Peptide Thromboxane Synthase Blocking Peptide

Thromboxane Synthase Blocking Peptide

Reference: 360715-200
€0.00 (tax incl.)
Peptide Sequence: human amino acids 359-377 (TNPDCQEKLLREVDVFKEK)(50,4150) · To be used in conjunction with Cayman’s thromboxane synthase polyclonal antibody (Catalog No. 160715) to block protein-antibody complex...
Caspase-3 (human) Blocking Peptide Caspase-3 (human) Blocking Peptide

Caspase-3 (human) Blocking Peptide

Reference: 360745-200
€0.00 (tax incl.)
Peptide Sequence: human caspase-3 sequence amino acids 166-183 (TELDSGIETDSGVDDDMA)(8444) · To be used in conjunction with Cayman’s Caspase-3 (human) Polyclonal Antibody (Catalog No. 160745) to block protein-antibody...
AIF Blocking Peptide AIF Blocking Peptide

AIF Blocking Peptide

Reference: 360773-1
€0.00 (tax incl.)
Peptide Sequence: human AIF amino acids 151-180 (RARDPGARVLIVSEDPELPYMRPPLSKELW) · To be used in conjunction with Cayman’s AIF polyclonal antibody (Catalog No. 160773) to block protein-antibody complex formation...
Apaf-1 Blocking Peptide Apaf-1 Blocking Peptide

Apaf-1 Blocking Peptide

Reference: 360780-200
€0.00 (tax incl.)
Peptide Sequence: human Apaf-1 amino acids 12-28 (HREALEKDIKTSYIMDHC); the sequence of the peptide is identical between human and mouse.(6894,6873) · To be used in conjunction with Cayman’s Apaf-1 polyclonal antibody...
nNOS Blocking Peptide nNOS Blocking Peptide

nNOS Blocking Peptide

Reference: 360871-200
€0.00 (tax incl.)
Peptide Sequence: human nNOS amino acids 1422-1433 (ESKKDTDEVFSS)(1280,4153) · To be used in conjunction with Cayman’s nNOS polyclonal antibody (Catalog No. 160870) to block protein-antibody complex formation during...
eNOS Blocking Peptide eNOS Blocking Peptide

eNOS Blocking Peptide

Reference: 360881-200
€0.00 (tax incl.)
Peptide Sequence: human eNOS amino acids 1186-1203 (RGAVPWAFDPPGSDTNS) · To be used in conjunction with Cayman’s eNOS polyclonal antiserum (Item No. 160880) to block protein-antibody complex formation during analysis...
Guanylate Cyclase α subunit (soluble) Blocking Peptide Guanylate Cyclase α subunit (soluble) Blocking Peptide

Guanylate Cyclase α subunit (soluble) Blocking Peptide

Reference: 360895-200
€0.00 (tax incl.)
Peptide sequences: human guanylate cyclase α subunit amino acids 418-436 (EQARAQDGLKKRLGKLKAT) · To be used in conjunction with Cayman’s guanylate cyclase α subunit polyclonal antibody (Catalog No. 160895) to block...
Guanylate Cyclase β1 subunit (soluble) Blocking Peptide Guanylate Cyclase β1 subunit (soluble) Blocking Peptide

Guanylate Cyclase β1 subunit (soluble) Blocking Peptide

Reference: 360897-200
€0.00 (tax incl.)
Peptide Sequence: soluble rat guanylate cyclase β1 subunit, amino acids 188-207 (EDFYEDLDRFEENGTQDSR; last D=E in human and bovine)(3531,4654,3535) · To be used in conjunction with Cayman’s guanylate cyclase β1...
CBX1 / HP1-Beta Peptide CBX1 / HP1-Beta Peptide

CBX1 / HP1-Beta Peptide

Reference: ARG56408
€0.00 (tax incl.)
This gene encodes a highly conserved nonhistone protein, which is a member of the heterochromatin protein family . The protein is enriched in the heterochromatin and associated with centromeres. The protein has a...
Human IL1 beta recombinant protein (Active) (His-tagged, C-ter) Human IL1 beta recombinant protein (Active) (His-tagged, C-ter)

Human IL1 beta recombinant protein (Active) (His-tagged, C-ter)

Reference: ARG70028
€0.00 (tax incl.)
IL1 beta protein is a member of the interleukin 1 cytokine family. This cytokine is produced by activated macrophages as a proprotein, which is proteolytically processed to its active form by caspase 1 (CASP1/ICE)....
Human IL2 recombinant protein (Active) (His-tagged, C-ter) Human IL2 recombinant protein (Active) (His-tagged, C-ter)

Human IL2 recombinant protein (Active) (His-tagged, C-ter)

Reference: ARG70029
€0.00 (tax incl.)
The protein encoded by this gene is a secreted cytokine that is important for the proliferation of T and B lymphocytes. The receptor of this cytokine is a heterotrimeric protein complex whose gamma chain is also...
Human IL6 recombinant protein (Active) (His-tagged, C-ter) Human IL6 recombinant protein (Active) (His-tagged, C-ter)

Human IL6 recombinant protein (Active) (His-tagged, C-ter)

Reference: ARG70030
€0.00 (tax incl.)
This gene encodes a cytokine that functions in inflammation and the maturation of B cells. In addition, the encoded protein has been shown to be an endogenous pyrogen capable of inducing fever in people with...
Human IL8 recombinant protein (Active) (His-tagged, C-ter) Human IL8 recombinant protein (Active) (His-tagged, C-ter)

Human IL8 recombinant protein (Active) (His-tagged, C-ter)

Reference: ARG70031
€0.00 (tax incl.)
The protein encoded by this gene is a member of the CXC chemokine family. This chemokine is one of the major mediators of the inflammatory response. This chemokine is secreted by several cell types. It functions as a...
Human IL10 recombinant protein (Active) (His-tagged, C-ter) Human IL10 recombinant protein (Active) (His-tagged, C-ter)

Human IL10 recombinant protein (Active) (His-tagged, C-ter)

Reference: ARG70032
€0.00 (tax incl.)
The protein encoded by this gene is a cytokine produced primarily by monocytes and to a lesser extent by lymphocytes. This cytokine has pleiotropic effects in immunoregulation and inflammation. It down-regulates the...
Human TNF alpha recombinant protein (Active) (His-tagged, C-ter) Human TNF alpha recombinant protein (Active) (His-tagged, C-ter)

Human TNF alpha recombinant protein (Active) (His-tagged, C-ter)

Reference: ARG70034
€0.00 (tax incl.)
This gene encodes a multifunctional proinflammatory cytokine that belongs to the tumor necrosis factor (TNF) superfamily. This cytokine is mainly secreted by macrophages. It can bind to, and thus functions through its...
Human GM-CSF recombinant protein (Active) (His-tagged, N-ter) Human GM-CSF recombinant protein (Active) (His-tagged, N-ter)

Human GM-CSF recombinant protein (Active) (His-tagged, N-ter)

Reference: ARG70037
€0.00 (tax incl.)
The protein encoded by this gene is a cytokine that controls the production, differentiation, and function of granulocytes and macrophages. The active form of the protein is found extracellularly as a homodimer. This...
Mouse TNF alpha recombinant protein (Active) (His-tagged, C-ter) Mouse TNF alpha recombinant protein (Active) (His-tagged, C-ter)

Mouse TNF alpha recombinant protein (Active) (His-tagged, C-ter)

Reference: ARG70041
€0.00 (tax incl.)
This gene encodes a multifunctional proinflammatory cytokine that belongs to the tumor necrosis factor (TNF) superfamily. This cytokine is mainly secreted by macrophages. It can bind to, and thus functions through its...
Human IL1 alpha recombinant protein (Active) (His-tagged, C-ter) Human IL1 alpha recombinant protein (Active) (His-tagged, C-ter)

Human IL1 alpha recombinant protein (Active) (His-tagged, C-ter)

Reference: ARG70042
€0.00 (tax incl.)
The protein encoded by this gene is a member of the interleukin 1 cytokine family. This cytokine is a pleiotropic cytokine involved in various immune responses, inflammatory processes, and hematopoiesis. This cytokine...
Human IL1RA recombinant protein (Active) (His-tagged, C-ter) Human IL1RA recombinant protein (Active) (His-tagged, C-ter)

Human IL1RA recombinant protein (Active) (His-tagged, C-ter)

Reference: ARG70044
€0.00 (tax incl.)
The protein encoded by this gene is a member of the interleukin 1 cytokine family. This protein inhibits the activities of interleukin 1, alpha (IL1A) and interleukin 1, beta (IL1B), and modulates a variety of...
Human IL3 recombinant protein (Active) (His-tagged, C-ter) Human IL3 recombinant protein (Active) (His-tagged, C-ter)

Human IL3 recombinant protein (Active) (His-tagged, C-ter)

Reference: ARG70046
€0.00 (tax incl.)
The protein encoded by this gene is a potent growth promoting cytokine. This cytokine is capable of supporting the proliferation of a broad range of hematopoietic cell types. It is involved in a variety of cell...
Human IL4 recombinant protein (Active) (His-tagged, C-ter) Human IL4 recombinant protein (Active) (His-tagged, C-ter)

Human IL4 recombinant protein (Active) (His-tagged, C-ter)

Reference: ARG70047
€0.00 (tax incl.)
The protein encoded by this gene is a pleiotropic cytokine produced by activated T cells. This cytokine is a ligand for interleukin 4 receptor. The interleukin 4 receptor also binds to IL13, which may contribute to...
Human IL5 recombinant protein (Active) (His-tagged, C-ter) Human IL5 recombinant protein (Active) (His-tagged, C-ter)

Human IL5 recombinant protein (Active) (His-tagged, C-ter)

Reference: ARG70048
€0.00 (tax incl.)
This gene encodes a cytokine that acts as a growth and differentiation factor for both B cells and eosinophils. The encoded cytokine plays a major role in the regulation of eosinophil formation, maturation,...
Human IL7 recombinant protein (Active) (His-tagged, C-ter) Human IL7 recombinant protein (Active) (His-tagged, C-ter)

Human IL7 recombinant protein (Active) (His-tagged, C-ter)

Reference: ARG70050
€0.00 (tax incl.)
The protein encoded by this gene is a cytokine important for B and T cell development. This cytokine and the hepatocyte growth factor (HGF) form a heterodimer that functions as a pre-pro-B cell growth-stimulating...
Human IL9 recombinant protein (Active) (His-tagged, N-ter) Human IL9 recombinant protein (Active) (His-tagged, N-ter)

Human IL9 recombinant protein (Active) (His-tagged, N-ter)

Reference: ARG70052
€0.00 (tax incl.)
The protein encoded by this gene is a cytokine that acts as a regulator of a variety of hematopoietic cells. This cytokine stimulates cell proliferation and prevents apoptosis. It functions through the interleukin 9...
Human IL11 recombinant protein (Active) (His-tagged, N-ter) Human IL11 recombinant protein (Active) (His-tagged, N-ter)

Human IL11 recombinant protein (Active) (His-tagged, N-ter)

Reference: ARG70054
€0.00 (tax incl.)
The protein encoded by this gene is a member of the gp130 family of cytokines. These cytokines drive the assembly of multisubunit receptor complexes, all of which contain at least one molecule of the transmembrane...
Human IL13 recombinant protein (Active) (His-tagged, C-ter) Human IL13 recombinant protein (Active) (His-tagged, C-ter)

Human IL13 recombinant protein (Active) (His-tagged, C-ter)

Reference: ARG70057
€0.00 (tax incl.)
This gene encodes an immunoregulatory cytokine produced primarily by activated Th2 cells. This cytokine is involved in several stages of B-cell maturation and differentiation. It up-regulates CD23 and MHC class II...

Menu

Settings

Please sign in first.

Sign in