Category: Proteins & Peptides

Filter By
Brand: Glycoselect Brand: PromoCell Brand: Signalchem Clear all
LRRKtide LRRKtide

LRRKtide

Reference: L10-58
€0.00 (tax incl.)
The LRRKtide peptide sequence (RLGRDKYKTLRQIRQ) is derived from human ezrin (amino acids 561-573), moesin (amino acids 539-553) and radixin (amino acids 558-570) and is suitable for use as a substrate for LRRK kinases.
MARCKS Peptide MARCKS Peptide

MARCKS Peptide

Reference: M02-58
€0.00 (tax incl.)
The synthetic peptide (KKRFSFKKSFKL) is derived from amino acid residues 154 –165 of protein myristoylated alanine-rich C-kinase substrate (MARCKS). This peptide is suitable for use as a substrate for PKC alpha, PKC...
Micro2 Peptide Micro2 Peptide

Micro2 Peptide

Reference: M08-58-1000
€0.00 (tax incl.)
The Micro2 Peptide sequence (KEEQSQITSQVTGQIGWR) is derived from human AP-2 complex subunit mu isoform b (amino acids 143-160) and is suitable as a substrate for AAK1, BMP2K, and GAK kinase assay.
MLC Peptide MLC Peptide

MLC Peptide

Reference: M09-58
€0.00 (tax incl.)
The MLC Peptide sequence (AKRPQRATSNVFS) represents the phosphate-accepting domain of human MYL9 (amino acids 12-23) and can be used as a substrate for PHKG1, PHKG2 and DAPK2.
Modified EIF2S Peptide Modified EIF2S Peptide

Modified EIF2S Peptide

Reference: E23-58B
€0.00 (tax incl.)
The Modified EIF2S Peptide sequence (Modified-CILLSELSRRRIR) is derived from human EIF2S1 (46-57) and is suitable for use as the substrate for EIF2AK kinase family and MNK1.
Modified PLKtide Modified PLKtide

Modified PLKtide

Reference: P41-58B
€0.00 (tax incl.)
The Modified PLKtide peptide sequence (Modified-CKKLGEDQAEEISDDLLEDSLSDEDE) is derived from the CDC25C protein sequence (182-204).
Modified SGKtide Modified SGKtide

Modified SGKtide

Reference: S08-58B
€0.00 (tax incl.)
The Modified SGKtide peptide sequence (Modified- CKKRNRRLSVA) contains serine protein kinase phosphorylation site and is evaluated as a substrate for SGK and NDR family kinases.
MRCL3 Peptide MRCL3 Peptide

MRCL3 Peptide

Reference: M56-58
€0.00 (tax incl.)
The synthetic substrate MRCL3 Peptide (KKRPQRATSN-VFAM-NH2) is derived from human myosin regulatory light chain MRCL3 (amino acid 11-24) and can be used for MLCK, MYLK2 and MYLK3 kinase assay.
PAKtide PAKtide

PAKtide

Reference: P08-58
€0.00 (tax incl.)
The 10 amino acids of PAKtide peptide (RRRLSFAEPG) contain a serine/threonine protein kinase phosphorylation site in a common seven-residue epitope (1, 2).
PDHKtide PDHKtide

PDHKtide

Reference: P57-58
€0.00 (tax incl.)
The synthetic peptide substrate PDHKtide (RRYHGHSMS-DPGVSYRTR) is derived from human PDHA1 protein (amino acid 288-304aa) and can be used for PDHK family kinase assay.
PDKtide PDKtide

PDKtide

Reference: P10-58
€0.00 (tax incl.)
The 39 amino acids of PDKtide peptide sequence (KTFCGTPEYLAPEVRREPRILSEEEQEMFRDFDYIADWC) is derived from two human proteins: residues 1-14 are based on AKT1 (307-320) and residues 16-39 are based on PKN2/PRK2 (961-984).
PKCtide PKCtide

PKCtide

Reference: P15-58
€0.00 (tax incl.)
The PKCtide peptide sequence (ERMRPRKRQGSVRRRV) is based on protein kinase C epsilon (amino acid 149-164).
PLKtide PLKtide

PLKtide

Reference: P41-58
€0.00 (tax incl.)
The PLKtide peptide sequence (CKKLGEDQAEEISDDLLED-SLSDEDE) is derived from the CDC25C protein sequence (182-204).
Poly (4:1 Glu, Tyr) Peptide Poly (4:1 Glu, Tyr) Peptide

Poly (4:1 Glu, Tyr) Peptide

Reference: P61-58
€0.00 (tax incl.)
The Poly (4:1 Glu, Tyr) substrate peptide is used as universal substrate for protein tyrosine kinases.
PS7-CTD Peptide PS7-CTD Peptide

PS7-CTD Peptide

Reference: R06-58-
€0.00 (tax incl.)
The PS7-CTD peptide sequence (YSPTS PpSYSP TSPpS) is derived from C-terminal repeat domain of human RNA polymerase II.
RS Repeat Peptide RS Repeat Peptide

RS Repeat Peptide

Reference: R55-58
€0.00 (tax incl.)
The synthetic peptide (GRSRSRSRSRSRSRSR) contains serine/threonine protein kinase phosphorylation sites and is routinely evaluated as a substrate for CLK, EIF2AK and SRPK family kinases.
SAMStide SAMStide

SAMStide

Reference: S07-58
€0.00 (tax incl.)
The SAMStide peptide sequence (HMRSAMSGLHLVKRR) is based on the mouse acetyl-Coenzyme A carboxylase alpha (amino acid 73-85).
SGKtide SGKtide

SGKtide

Reference: S08-58
€0.00 (tax incl.)
The SGKtide peptide sequence (CKKRNRRLSVA) contains serine protein kinase phosphorylation site and is evaluated as a substrate for SGK and NDR family kinases.
TGFBR1 Peptide TGFBR1 Peptide

TGFBR1 Peptide

Reference: T36-58
€0.00 (tax incl.)
The TGFBR1 peptide sequence (KKKVLTQMGSPSIRC-S(pS)VS) is derived from human SMAD3 (215-230) and is suitable for use as the substrate for TGFBR1 superfamily, including ACVRs (ALK1, ALK2, ALK4 and ALK7) and BMPRs (ALK3...
Thr-phosphopeptide Thr-phosphopeptide

Thr-phosphopeptide

Reference: T69-58
€0.00 (tax incl.)
The Thr-phosphopeptide sequence (KRT(p)IRR) is derived from human NR2F6 (amino acids 79-84) and is suitable as a substrate for PP2A, PP2B, PP2C and PP1.
Thr-phosphopeptide-3 Thr-phosphopeptide-3

Thr-phosphopeptide-3

Reference: T72-58-01
€0.00 (tax incl.)
The Thr-phosphopeptide-3 sequence (RRAT(p)VA) is a phosphorylated threonyl derivative from human pyruvate kinase (amino acids 40-45) and is suitable as a substrate for PP1, PP2A, and PP2C (e.g. WIP1).
Tyr-phosphopeptide-2 Tyr-phosphopeptide-2

Tyr-phosphopeptide-2

Reference: T70-58
€0.00 (tax incl.)
The Tyr-phosphopeptide-2 sub peptide sequence (DADEY(p)LIPDQG) is based on mouse epidermal growth factor receptor isoform 1 (amino acid 1014-1024).
ULKtide ULKtide

ULKtide

Reference: U01-58-1
€0.00 (tax incl.)
The ULKtide synthetic peptide [YANWLAASIYLDGKKK] is routinely evaluated as a substrate for ULK family kinase assays.
ZIPtide ZIPtide

ZIPtide

Reference: Z16-58
€0.00 (tax incl.)
The ZIPtide substrate peptide sequence (KKLNRTLSFAEPG) is routinely evaluated as a substrate for DAPK3 (ZIPK).
ARPP19 Protein ARPP19 Protein

ARPP19 Protein

Reference: A76-54G-50
€0.00 (tax incl.)
Full-length recombinant human ARPP19 was expressed in E. coli cells using an N-terminal GST tag.
ARPP19 Protein ARPP19 Protein

ARPP19 Protein

Reference: A76-54G-200
€0.00 (tax incl.)
Full-length recombinant human ARPP19 was expressed in E. coli cells using an N-terminal GST tag.
Casein Protein Casein Protein

Casein Protein

Reference: C03-54N
€0.00 (tax incl.)
Native casein protein was purified from bovine milk.
Histone H1 Protein Histone H1 Protein

Histone H1 Protein

Reference: H10-54N
€0.00 (tax incl.)
Native histone H1 was purified from bovine thymus tissues.
Histone H3 Protein Histone H3 Protein

Histone H3 Protein

Reference: H12-54N
€0.00 (tax incl.)
Native histone H3 was purified from bovine thymus tissues.
LC20 Protein LC20 Protein

LC20 Protein

Reference: M89-54G-50
€0.00 (tax incl.)
Recombinant full-length mouse LC20 was expressed in E. coli cells using an N-terminal GST tag.
LC20 Protein LC20 Protein

LC20 Protein

Reference: M89-54G-200
€0.00 (tax incl.)
Recombinant full-length mouse LC20 was expressed in E. coli cells using an N-terminal GST tag.
MBP Protein MBP Protein

MBP Protein

Reference: M42-51N
€0.00 (tax incl.)
Native Swine MBP was extracted under acidic conditions and further purified by cation chromatography from pig brain (1). This product is routinely evaluated using active MAP Kinase 3/ERK1.
Moesin Protein Moesin Protein

Moesin Protein

Reference: M52-55G-50
€0.00 (tax incl.)
Recombinant human Moesin (410-end) was expressed in E. coli cells using an N-terminal GST tag.
Moesin Protein Moesin Protein

Moesin Protein

Reference: M52-55G-200
€0.00 (tax incl.)
Recombinant human Moesin (410-end) was expressed in E. coli cells using an N-terminal GST tag.
PDHA1 Protein PDHA1 Protein

PDHA1 Protein

Reference: P57-55H-50
€0.00 (tax incl.)
Recombinant human PDHA1 (30-390) was expressed in E. coli cells using an N-terminal His tag.
PDHA1 Protein PDHA1 Protein

PDHA1 Protein

Reference: P57-55H-200
€0.00 (tax incl.)
Recombinant human PDHA1 (30-390) was expressed in E. coli cells using an N-terminal His tag.
RanGAP1 Protein RanGAP1 Protein

RanGAP1 Protein

Reference: R298-31H-20
€0.00 (tax incl.)
Recombinant human RanGAP1 (418-end) was expressed in E. coli cells using an N-terminal his tag.
RanGAP1 Protein RanGAP1 Protein

RanGAP1 Protein

Reference: R298-31H-50
€0.00 (tax incl.)
Recombinant human RanGAP1 (418-end) was expressed in E. coli cells using an N-terminal his tag.
2019-nCoV Spike protein S1 (Omicron) 2019-nCoV Spike protein S1 (Omicron)

2019-nCoV Spike protein S1 (Omicron)

Reference: C19S1-G231OH-10
€0.00 (tax incl.)
Recombinant 2019-nCoV Spike protein S1 (A67V, Δ69-70, T95I, G142D/Δ143-145, Δ211/L212I, ins214EPE, G339D, S371L, S373P, S375F, K417N, N440K, G446S, S477N, T478K, E484A, Q493R, G496S, Q498R, N501Y, Y505H, T547K, D614G,...
2019-nCoV Spike protein S1 (Omicron) 2019-nCoV Spike protein S1 (Omicron)

2019-nCoV Spike protein S1 (Omicron)

Reference: C19S1-G231OH-20
€0.00 (tax incl.)
Recombinant 2019-nCoV Spike protein S1 (A67V, Δ69-70, T95I, G142D/Δ143-145, Δ211/L212I, ins214EPE, G339D, S371L, S373P, S375F, K417N, N440K, G446S, S477N, T478K, E484A, Q493R, G496S, Q498R, N501Y, Y505H, T547K, D614G,...
2019-nCoV Spike protein S1 (Omicron) 2019-nCoV Spike protein S1 (Omicron)

2019-nCoV Spike protein S1 (Omicron)

Reference: C19S1-G231OH-50
€0.00 (tax incl.)
Recombinant 2019-nCoV Spike protein S1 (A67V, Δ69-70, T95I, G142D/Δ143-145, Δ211/L212I, ins214EPE, G339D, S371L, S373P, S375F, K417N, N440K, G446S, S477N, T478K, E484A, Q493R, G496S, Q498R, N501Y, Y505H, T547K, D614G,...
2019-nCoV Spike protein S1 (Omicron) 2019-nCoV Spike protein S1 (Omicron)

2019-nCoV Spike protein S1 (Omicron)

Reference: C19S1-G231OH-100
€0.00 (tax incl.)
Recombinant 2019-nCoV Spike protein S1 (A67V, Δ69-70, T95I, G142D/Δ143-145, Δ211/L212I, ins214EPE, G339D, S371L, S373P, S375F, K417N, N440K, G446S, S477N, T478K, E484A, Q493R, G496S, Q498R, N501Y, Y505H, T547K, D614G,...

Menu

Settings

Please sign in first.

Sign in