Filter By
Filter By
Category: Proteins & Peptides
Filter By
Reference: HY-P3523
€0.00
(tax incl.)
KGDS is synthetic peptides, targeting integrin GPIIb-IIIa located on the membrane of human activated platelets. Amino acid sequence: Lys-Gly-Asp-Ser.
Reference: HY-W009392
€0.00
(tax incl.)
(S)-2-((S)-2-Amino-3-(1H-imidazol-4-yl)propanamido)-4-methylpentanoic acid is a leucine derivative.
Reference: HY-W041983
€0.00
(tax incl.)
Fmoc-Cpa-OH is a compound containing both an amino group and a carboxyl group.
Reference: HY-105037
€0.00
(tax incl.)
Forigerimod (IPP-201101) is a CD4 T-cell modulator. Forigerimod is a 21-amino-acid fragment of U1 small nuclear ribonucleoprotein 70 kDa that is phosphorylated at Ser140. Forigerimod can potently inhibit autophagy....
Reference: HY-P3866
€0.00
(tax incl.)
[Asu1,6]-Oxytocin is an analog of oxytocin. [Asu1,6]-Oxytocin reverses insulin resistance and glucose intolerance prior to reduction of obesity. [Asu1,6]-Oxytocin has the potential for the research of obesity and...
Reference: HY-W142081
€0.00
(tax incl.)
N-(2,4-Dinitrophenyl)-L-serine is a serine derivative.
Reference: HY-78733
€0.00
(tax incl.)
N-Fmoc-L-valine N-succinimidyl ester is a valine derivative.
Reference: HY-P4027
€0.00
(tax incl.)
HCV-1 e2 Protein (554-569) is one of the main antigenic regions of HCV envelope 2 (e2) protein. The HCV-1 e2 Protein (554-569) contains a putative n-glycosylation site, which was previously thought to influence the...
Reference: HY-P1186
€0.00
(tax incl.)
Eledoisin Related Peptide is a Substance P analog that excites neurons and triggers behavioral responses. Eledoisin Related Peptide is also a tachykinin receptor ligand.
Reference: HY-W068839
€0.00
(tax incl.)
L-Phenylalanyl-L-leucine is a leucine derivative.
Reference: HY-105239
€0.00
(tax incl.)
Selepressin (FE 202158) is a selective vasopressin V1A receptor agonist. Selepressin is a potent vasopressor. Selepressin can be used in the research of septic shock.
Reference: HY-P3414
€0.00
(tax incl.)
Proteasome-activating peptide 1 is a peptide, which increases the chymotrypsin-like proteasomal catalytic activity and, consequently, proteolytic rates both in vitro and in culture. Proteasome-activating peptide 1...
Reference: HY-60256
€0.00
(tax incl.)
(R)-Pyrrolidine-3-carboxylic acid is a proline derivative.
Reference: HY-P1475
€0.00
(tax incl.)
C-Peptide, dog is a component of proinsulin, released from pancreatic beta cells into blood together with
insulin.
Reference: HY-P1567
€0.00
(tax incl.)
β-Amyloid (10-35), amide is composed of 26 aa (10-35 residues of the Aβ peptide) and is the primary component of the amyloid plaques of Alzheimer’s disease.
Reference: HY-P3944
€0.00
(tax incl.)
Calmodulin Dependent Protein Kinase Substrate is a Ca2+- and calmodulin (CaM)-dependent protein kinase (CaMK) substrate peptide. Calmodulin Dependent Protein Kinase Substrate is a synthetic peptide substrate for...
Reference: HY-P1573A
€0.00
(tax incl.)
Brain Natriuretic Peptide-45, rat TFA (BNP-45, rat TFA) is a circulating form of rat brain natriuretic peptide isolated from rat heart with potent hypotensive and natriuretic potency.
Reference: HY-P1875
€0.00
(tax incl.)
TNF-α (46-65), human is a peptide of TNF-α.
Reference: HY-P1050
€0.00
(tax incl.)
COG 133 is a fragment of Apolipoprotein E (APOE) peptide. COG 133 competes with the ApoE holoprotein for binding the LDL receptor, with potent anti-inflammatory and neuroprotective effects. COG 133 is also a nAChR...
Reference: HY-P2253
€0.00
(tax incl.)
H3K27(Me2) (15-34), a histone peptide, is a repressive chromatin mark derived from human histone. Polycomb Repressive Complex 2 (PRC2) is a multiprotein complex that catalyzes the methylation of H3K27(Me).
Reference: HY-P0277
€0.00
(tax incl.)
Carcinoembryonic Antigen (CEA) is a tumor marker in lung cancer.
Reference: HY-P1145
€0.00
(tax incl.)
Glucagon-like peptide 1 (1-37), human is a highly potent agonist of the GLP-1 receptor.
Reference: HY-P3981
€0.00
(tax incl.)
Defensin NP-3A (NP-3A; Corticostatin 1) is a human granulocyte peptide, with anti-ACTH activity. Defensins are antimicrobial peptides with and cytotoxic activity.
Reference: HY-P1758
€0.00
(tax incl.)
IFN-α Receptor Recognition Peptide 1 is a peptide of IFN-α associated with receptor interactions.
Reference: HY-W011001
€0.00
(tax incl.)
(R)-2-((((9H-Fluoren-9-yl)methoxy)carbonyl)amino)-3-cyclohexylpropanoic acid is an alanine derivative.
Reference: HY-P0289
€0.00
(tax incl.)
CEF3 (SIIPSGPLK) corresponds to aa 13-21 of the influenza A virus M1 protein. The matrix (M1) protein of influenza A virus is a multifunctional protein that plays essential structural and functional roles in the virus...
Reference: HY-P1524
€0.00
(tax incl.)
β-Amyloid (1-14),mouse,rat is a 1 to 14 fragment of Amyloid-β peptide.
Reference: HY-125486
€0.00
(tax incl.)
Reversin 121 is a P-glycoprotein inhibitor. Reversin 121 increases the ATPase activity of MDR1. Reversin 121 reverses P-glycoprotein-mediated multidrug resistance. Reversin 121 can be used in the research of cancers.
Reference: HY-P3414A
€0.00
(tax incl.)
Proteasome-activating peptide 1 TFA is a peptide and a potent proteasome activator. Proteasome-activating peptide 1 TFA increases the chymotrypsin-like proteasomal catalytic activity and, consequently, proteolytic...
Reference: HY-P0261B
€0.00
(tax incl.)
Indolicidin TFA is a potent antimicrobial peptide purified from the cytoplasmic granules of bovine neutrophils.
Reference: HY-W003225
€0.00
(tax incl.)
3-Bromo-DL-phenylalanine is a phenylalanine derivative.
Reference: HY-12537
€0.00
(tax incl.)
Peptide 401, a potent mast cell degranulating factor from bee venom, suppresses the increased vascular permeability due to intradermal injection of various smooth muscle spasmogens (histamine, and 5-HT).
Reference: HY-P3155
€0.00
(tax incl.)
Ac-hMCH(6-16)-NH2 binds to and activates equally well both human MCH receptors present in the brain (non-selective agonist), with IC50 values of 0.16 nM and 2.7 nM for MCH-1R and MCH-2R.
Reference: HY-P1483
€0.00
(tax incl.)
Urotensin II, mouse is an endogenous ligand for the orphan G-protein-coupled receptor GPR14 or SENR. Urotensin II, mouse is a potent vasoconstrictor. Urotensin II, mouse plays a physiological role in the central...
Reference: HY-P2311
€0.00
(tax incl.)
Defensin HNP-2 human is an endogenous antibiotic peptide and monocyte chemotactic peptide produced by human neutrophils.
Reference: HY-P1860
€0.00
(tax incl.)
TNF-α (31-45), human is a peptide of tumor necrosis factor-α.
Reference: HY-118349
€0.00
(tax incl.)
Dansylphenylalanine is a phenylalanine derivative.
Reference: HY-W011324
€0.00
(tax incl.)
(S)-2-((tert-Butoxycarbonyl)amino)-4-(cyclohexyloxy)-4-oxobutanoic acid is an aspartic acid derivative.
Reference: HY-P0329
€0.00
(tax incl.)
X-press Tag Peptide is a tag peptide used for protein purification. X-press Tag is also an N-terminal leader peptide; this N-terminal peptide contains a polyhistidine sequence, the Xpress epitope (part of...
Reference: HY-P3901
€0.00
(tax incl.)
[Leu8,D-Trp22,Tyr25] Somatostatin-28 is the analog of Somatostatin-28. Somatostatin-28 is a intestinal peptide containing somatostatin in its C-terminal portion.
Reference: HY-P2397
€0.00
(tax incl.)
Fmoc-Asn(Trt)-Thr(psi(Me,Me)pro)-OH is a dipeptide.
Reference: HY-P3968
€0.00
(tax incl.)
Thrombospondin-1 (1016-1021) (human, bovine, mouse), a Thrombospondin-1-derived peptide, is a truncated peptide devoid of CD47-binding activity.
Reference: HY-P1965
€0.00
(tax incl.)
Ac-IEVDIDV TFA is a short peptide sequence with Ac at the end.
Reference: HY-P2292A
€0.00
(tax incl.)
Omiganan-FITC TFA is a peptide-FITC complex composed of Omiganan and a FITC. Omiganan is a bactericidal and fungicidal cationic peptide being developed as a topical gel for prevention of catheter-associated infections.
Reference: HY-P1792A
€0.00
(tax incl.)
Angiotensin II (1-4), human (TFA) is an endogenous peptide produced from AT I by angiotensin-converting-enzyme (ACE). Angiotensin II binds the AT II type 1 (AT1) receptor, stimulating GPCRs in vascular smooth muscle...
Reference: HY-P2522
€0.00
(tax incl.)
Competence-Stimulating Peptide-2 (CSP-2) is a quorum sensing signal peptide produced by Streptococcus pneumoniae. ComD2 is a compatible receptor of Competence-Stimulating Peptide-2 (CSP-2) with an EC50 value of 50.7 nM.
Reference: HY-W013824
€0.00
(tax incl.)
Boc-D-Phe(3,4-DiF)-OH is a phenylalanine derivative.
Reference: HY-20861
€0.00
(tax incl.)
(R)-2-amino-3-cyclobutylpropanoic acid is an alanine derivative.
Reference: HY-P3278A
€0.00
(tax incl.)
Caloxin 2A1 TFA is an extracellular plasma membrane Ca2+-ATPase (PMCA) peptide inhibitor. Caloxin 2A1 TFA does not affect basal Mg2+-ATPase or Na+-K+-ATPase.
Reference: HY-34597
€0.00
(tax incl.)
(S)-2-Amino-3-(4-bromophenyl)propanoic acid is a phenylalanine derivative.
Reference: HY-P1924
€0.00
(tax incl.)
Interphotoreceptor retinoid-binding protein(668-687), the amino acid residues 668 to 687 of human interphotoreceptor retinoid binding protein (IRBP), induces uveitis.
Reference: HY-P2148
€0.00
(tax incl.)
P-113 is an antimicrobial peptide (AMP) derived from the human salivary protein histatin 5. P-113 is active against clinically important microorganisms such as Pseudomonas spp., Staphylococcus spp., and C. albicans.
Reference: HY-P1568
€0.00
(tax incl.)
Flagelin 22 (Flagellin 22), a fragment of bacterial flagellin, is an effective elicitor in both plants and algae.
Reference: HY-P2454
€0.00
(tax incl.)
CSP1 is a potent and selective ComD1 receptor agonist, with an IC50 of 10.3 nM. CSP1 is a major variants of competence-stimulating peptide (CSP), and it can regulate genetic transformation of S. pneumonia by...
Reference: HY-P1231
€0.00
(tax incl.)
GTFTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is an Exendin-4 peptide derivative.
Reference: HY-P1210A
€0.00
(tax incl.)
Lys-γ3-MSH(human) TFA is a melanocortin peptide derived from the C-terminal of the fragment of pro-opiomelanocortin (POMC). Lys-γ3-MSH(human) TFA potentiates the steroidogenic response of the rat adrenal to...
Reference: HY-P1390A
€0.00
(tax incl.)
d[Cha4]-AVP TFA is a potent and selective vasopressin (AVP) V1b receptor agonist with a Ki of 1.2 nM for human V1b receptor. d[Cha4]-AVP TFA shows more selective for V1b receptor than human V1a receptor, V2 receptor,...
Reference: HY-W008688
€0.00
(tax incl.)
Fmoc-L-Norleucine is a leucine derivative.
Reference: HY-W052310
€0.00
(tax incl.)
Methyl ((benzyloxy)carbonyl)-D-serinate is a serine derivative.
Reference: HY-P1844A
€0.00
(tax incl.)
Chemerin-9 (149-157) TFA is a potent agonist of chemokine-like receptor 1 (CMKLR1) . Chemerin-9 (149-157) TFA has anti-inflammatory activity. Chemerin-9 (149-157) TFA stimulates phosphorylation of Akt and ERK as well...
Reference: HY-P3591
€0.00
(tax incl.)
YMRF-NH2 is a neuropeptide. YMRF-NH2 binds to FMRFa-R with an EC50 value of 31 nM.
Reference: HY-P1428A
€0.00
(tax incl.)
RFRP-1(human) TFA is a potent endogenous NPFF receptor agonist (EC50 values are 0.0011 and 29 nM for NPFF2 and NPFF1, respectively). Attenuates contractile function of isolated rat and rabbit cardiac myocytes. Reduces...
Reference: HY-W048701
€0.00
(tax incl.)
(((9H-Fluoren-9-yl)methoxy)carbonyl)-D-histidine is a histidine derivative.
Reference: HY-P3743
€0.00
(tax incl.)
p60c-src Substrate is an efficient and specific substrate for p60c-src protein tyrosine kinase (PTK). p60c-src Substrate can be used to synthesize chimeric branched peptides.
Reference: HY-P1574
€0.00
(tax incl.)
[Arg8]-Vasotocin is a vertebrate neurohypophyseal peptide of the vasopressin/oxytocin hormone family.
Reference: HY-P3609
€0.00
(tax incl.)
CR 665 (JNJ 38488502) is a peripherally selective κ-opioid agonist. CR 665 can activate the kappa opioid receptor with EC50 value of 10.9 nM. CR 665 can be used for the research of peripheral pain.
Reference: HY-P2530
€0.00
(tax incl.)
KALA is an amphiphilic peptide that forms an α-helical structure at physiological pH. KALA modifies a plasmid DNA-encapsulating liposomal membrane and is used as a fusogenic peptide in order to achieve effective liver...
Reference: HY-W040416
€0.00
(tax incl.)
(S)-2-(((Benzyloxy)carbonyl)amino)pent-4-enoic acid is a Glycine (HY-Y0966) derivative.
Reference: HY-P0002A
€0.00
(tax incl.)
Protirelin Acetate is a highly conserved neuropeptide that exerts the hormonal control of thyroid-stimulating hormone (TSH) levels as well as neuromodulatory functions.
Reference: HY-P0215A
€0.00
(tax incl.)
Autocamtide-2-related inhibitory peptide, myristoylated TFA is the myristoylated Autocamtide-2-related inhibitory peptide. Autocamtide-2-related inhibitory peptide is a highly specific and potent inhibitor of CaMKII...
Reference: HY-P3204
€0.00
(tax incl.)
POT-4 (AL-78898A), a Compstatin derivative, is a potent inhibitor of complement factor C3 activation. POT-4 can be used for age-related macular degeneration research
Reference: HY-106262B
€0.00
(tax incl.)
Delcasertib (KAI-9803) hydrochloride is a potent and selective δ-protein kinase C (δPKC) inhibitor. Delcasertib (KAI-9803) hydrochloride could ameliorate injury associated with ischemia and reperfusion in animal...
Reference: HY-P2502
€0.00
(tax incl.)
Hepatitis Virus C NS3 Protease Inhibitor 2 is a product-based peptide inhibitor of hepatitis C virus (HCV) NS3 protease, with a Ki of 41 nM.
Reference: HY-W009913
€0.00
(tax incl.)
2-((Carboxymethyl)amino)benzoic acid is a Glycine (HY-Y0966) derivative.
Reference: HY-P1493
€0.00
(tax incl.)
Fibrinopeptide B, human is a 14-aa peptide, released from the amino-terminus of β-chains of fibrinogen by thrombin.
Reference: HY-P3725
€0.00
(tax incl.)
H-Leu-Ser-Phe(NO2)-Nle-Ala-OMe TFA is a substrate for chymosin.
Reference: HY-W091734
€0.00
(tax incl.)
Methyl 4-iodo-L-phenylalaninate hydrochloride is a Phenylalaninate derivative. Methyl 4-iodo-L-phenylalaninate hydrochloride can be used for the preparation of factor XI modulators used in the research of thrombotic...
Reference: HY-P0256
€0.00
(tax incl.)
Apamin (Apamine) is an 18 amino acid peptide neurotoxin found in apitoxin (bee venom), is known as a specifically selective blocker of Ca2+-activated K+ (SK) channels and exhibits anti-inflammatory and anti-fibrotic...
Reference: HY-P1019
€0.00
(tax incl.)
[Ala1,3,11,15]-Endothelin (53-63) is an ETB agonist. [Ala1,3,11,15]-Endothelin (53-63) has selectivity for ETB with IC50 values range from 0.33 nM to 0.61 nM. [Ala1,3,11,15]-Endothelin (53-63) can be used for the...
Reference: HY-P1497
€0.00
(tax incl.)
Bradykinin (1-3) is a 3-amino acid residue peptide. Bradykinin (1-3) is an amino-truncated Bradykinin peptide, cleaved by Prolyl endopeptidase.
Reference: HY-P1257A
€0.00
(tax incl.)
Xenin-8 TFA, a C-terminal octapeptide, is a biologically active fragment of Xenin. Xenin is a 25-amino acid peptide of the neurotensin/xenopsin family. Xenin-8 TFA stimulates basal insulin secretion and potentiates...
Reference: HY-148209
€0.00
(tax incl.)
Balhimycin is a glycopeptide antibiotic, found from the fermentation broth of a Amycolatopsis sp. Balhimycin shows anti-bacterial activity against staphylococci and anaerobes.
Reference: HY-P2317
€0.00
(tax incl.)
Cecropin P1, porcine is an antibacterial peptide that can be isolated from the upper part of the small intestine of the pig. Cecropin P1, porcine shows antibacterial activity against Gram-negative bacteria. Cecropin...
Reference: HY-P1141A
€0.00
(tax incl.)
GLP-1(9-36)amide TFA is a major metabolite of glucagon-like peptide-1-(7-36) amide formed by the enzyme dipeptidyl peptidase-4 (DPP-4). GLP-1(9-36)amide TFA acts as an antagonist to the human pancreatic GLP-1 receptor.
Reference: HY-P3900
€0.00
(tax incl.)
[Tyr0,D-Trp8] Somatostatin is the analog of Somatostatin.
Reference: HY-W011002
€0.00
(tax incl.)
Fmoc-3-Ala(2-thienyl)-OH is an alanine derivative.
Reference: HY-107627
€0.00
(tax incl.)
MCL0020 is a potent and selective melanocortin MC4 receptor antagonist, with an IC50 of 11.63 nM. MCL0020 dose-dependently and significantly attenuates restraint stress-induced anorexia without affecting food intake.