Filter By
Filter By
Category: Proteins & Peptides
Filter By
Reference: HY-P3911
€0.00
(tax incl.)
CAP 37 (20-44) is a peptide based on amino acid residues 20 through 44 of CAP37. CAP37, a Cationic antimicrobial protein of 37 kDa, is a multifunctional protein.
Reference: HY-P1260
€0.00
(tax incl.)
FSLLRY-NH2 is a protease-activated receptor 2 (PAR2) inhibitor.
Reference: HY-P1624
€0.00
(tax incl.)
Teduglutide is a dipeptidyl peptidase IV resistant glucagon-like peptide 2 (GLP-2) analogue. Teduglutide is associated with trophic effects on gut mucosa. Teduglutide can be used for the research of short bowel...
Reference: HY-P3845
€0.00
(tax incl.)
(Gly22)-Amyloid β-Protein (1-42) is a peptide fragment of amyloid β-protein (Aβ). Amyloid β-protein is the primary component of both vascular and parenchymal amyloid deposits in Alzheimer's disease. Mutation of Glu22...
Reference: HY-W011200
€0.00
(tax incl.)
H-Gly-OBzl.TosOH is a Glycine (HY-Y0966) derivative.
Reference: HY-W065053
€0.00
(tax incl.)
trans-N-Methyl-4-methoxyproline is a natural product that can be isolated from the stems of Petiveria alliacea and is also a Proline derivative.
Reference: HY-P2004
€0.00
(tax incl.)
FFAGLDD is MMP9 selective cleavage peptides, which used for cytosolic delivery of Doxorubi-cin (DOX) and achieve temporally and spatially controlled slow drug delivery and release.
Reference: HY-W013659
€0.00
(tax incl.)
Fmoc-Asp(OcHex)-OH is an aspartic acid derivative.
Reference: HY-P1294A
€0.00
(tax incl.)
α-Helical CRF(9-41) TFA is a competitive CRF2 receptor antagonist with KB of ~100 nM. α-Helical CRF(9-41) TFA is also a partial agonist of CRF1 receptor with an EC50 of 140 nM.
Reference: HY-P3523
€0.00
(tax incl.)
KGDS is synthetic peptides, targeting integrin GPIIb-IIIa located on the membrane of human activated platelets. Amino acid sequence: Lys-Gly-Asp-Ser.
Reference: HY-W009392
€0.00
(tax incl.)
(S)-2-((S)-2-Amino-3-(1H-imidazol-4-yl)propanamido)-4-methylpentanoic acid is a leucine derivative.
Reference: HY-W041983
€0.00
(tax incl.)
Fmoc-Cpa-OH is a compound containing both an amino group and a carboxyl group.
Reference: HY-105037
€0.00
(tax incl.)
Forigerimod (IPP-201101) is a CD4 T-cell modulator. Forigerimod is a 21-amino-acid fragment of U1 small nuclear ribonucleoprotein 70 kDa that is phosphorylated at Ser140. Forigerimod can potently inhibit autophagy....
Reference: HY-P3866
€0.00
(tax incl.)
[Asu1,6]-Oxytocin is an analog of oxytocin. [Asu1,6]-Oxytocin reverses insulin resistance and glucose intolerance prior to reduction of obesity. [Asu1,6]-Oxytocin has the potential for the research of obesity and...
Reference: HY-W142081
€0.00
(tax incl.)
N-(2,4-Dinitrophenyl)-L-serine is a serine derivative.
Reference: HY-78733
€0.00
(tax incl.)
N-Fmoc-L-valine N-succinimidyl ester is a valine derivative.
Reference: HY-P4027
€0.00
(tax incl.)
HCV-1 e2 Protein (554-569) is one of the main antigenic regions of HCV envelope 2 (e2) protein. The HCV-1 e2 Protein (554-569) contains a putative n-glycosylation site, which was previously thought to influence the...
Reference: HY-P1186
€0.00
(tax incl.)
Eledoisin Related Peptide is a Substance P analog that excites neurons and triggers behavioral responses. Eledoisin Related Peptide is also a tachykinin receptor ligand.
Reference: HY-W068839
€0.00
(tax incl.)
L-Phenylalanyl-L-leucine is a leucine derivative.
Reference: HY-105239
€0.00
(tax incl.)
Selepressin (FE 202158) is a selective vasopressin V1A receptor agonist. Selepressin is a potent vasopressor. Selepressin can be used in the research of septic shock.
Reference: HY-P3414
€0.00
(tax incl.)
Proteasome-activating peptide 1 is a peptide, which increases the chymotrypsin-like proteasomal catalytic activity and, consequently, proteolytic rates both in vitro and in culture. Proteasome-activating peptide 1...
Reference: HY-60256
€0.00
(tax incl.)
(R)-Pyrrolidine-3-carboxylic acid is a proline derivative.
Reference: HY-P1475
€0.00
(tax incl.)
C-Peptide, dog is a component of proinsulin, released from pancreatic beta cells into blood together with
insulin.
Reference: HY-P1567
€0.00
(tax incl.)
β-Amyloid (10-35), amide is composed of 26 aa (10-35 residues of the Aβ peptide) and is the primary component of the amyloid plaques of Alzheimer’s disease.
Reference: HY-P3944
€0.00
(tax incl.)
Calmodulin Dependent Protein Kinase Substrate is a Ca2+- and calmodulin (CaM)-dependent protein kinase (CaMK) substrate peptide. Calmodulin Dependent Protein Kinase Substrate is a synthetic peptide substrate for...
Reference: HY-P1573A
€0.00
(tax incl.)
Brain Natriuretic Peptide-45, rat TFA (BNP-45, rat TFA) is a circulating form of rat brain natriuretic peptide isolated from rat heart with potent hypotensive and natriuretic potency.
Reference: HY-P1875
€0.00
(tax incl.)
TNF-α (46-65), human is a peptide of TNF-α.
Reference: HY-P1050
€0.00
(tax incl.)
COG 133 is a fragment of Apolipoprotein E (APOE) peptide. COG 133 competes with the ApoE holoprotein for binding the LDL receptor, with potent anti-inflammatory and neuroprotective effects. COG 133 is also a nAChR...
Reference: HY-P2253
€0.00
(tax incl.)
H3K27(Me2) (15-34), a histone peptide, is a repressive chromatin mark derived from human histone. Polycomb Repressive Complex 2 (PRC2) is a multiprotein complex that catalyzes the methylation of H3K27(Me).
Reference: HY-P0277
€0.00
(tax incl.)
Carcinoembryonic Antigen (CEA) is a tumor marker in lung cancer.
Reference: HY-P1145
€0.00
(tax incl.)
Glucagon-like peptide 1 (1-37), human is a highly potent agonist of the GLP-1 receptor.
Reference: HY-P3981
€0.00
(tax incl.)
Defensin NP-3A (NP-3A; Corticostatin 1) is a human granulocyte peptide, with anti-ACTH activity. Defensins are antimicrobial peptides with and cytotoxic activity.
Reference: HY-P1758
€0.00
(tax incl.)
IFN-α Receptor Recognition Peptide 1 is a peptide of IFN-α associated with receptor interactions.
Reference: HY-W011001
€0.00
(tax incl.)
(R)-2-((((9H-Fluoren-9-yl)methoxy)carbonyl)amino)-3-cyclohexylpropanoic acid is an alanine derivative.
Reference: HY-P0289
€0.00
(tax incl.)
CEF3 (SIIPSGPLK) corresponds to aa 13-21 of the influenza A virus M1 protein. The matrix (M1) protein of influenza A virus is a multifunctional protein that plays essential structural and functional roles in the virus...
Reference: HY-P1524
€0.00
(tax incl.)
β-Amyloid (1-14),mouse,rat is a 1 to 14 fragment of Amyloid-β peptide.
Reference: HY-125486
€0.00
(tax incl.)
Reversin 121 is a P-glycoprotein inhibitor. Reversin 121 increases the ATPase activity of MDR1. Reversin 121 reverses P-glycoprotein-mediated multidrug resistance. Reversin 121 can be used in the research of cancers.
Reference: HY-P3414A
€0.00
(tax incl.)
Proteasome-activating peptide 1 TFA is a peptide and a potent proteasome activator. Proteasome-activating peptide 1 TFA increases the chymotrypsin-like proteasomal catalytic activity and, consequently, proteolytic...
Reference: HY-P0261B
€0.00
(tax incl.)
Indolicidin TFA is a potent antimicrobial peptide purified from the cytoplasmic granules of bovine neutrophils.
Reference: HY-W003225
€0.00
(tax incl.)
3-Bromo-DL-phenylalanine is a phenylalanine derivative.
Reference: HY-12537
€0.00
(tax incl.)
Peptide 401, a potent mast cell degranulating factor from bee venom, suppresses the increased vascular permeability due to intradermal injection of various smooth muscle spasmogens (histamine, and 5-HT).
Reference: HY-P3155
€0.00
(tax incl.)
Ac-hMCH(6-16)-NH2 binds to and activates equally well both human MCH receptors present in the brain (non-selective agonist), with IC50 values of 0.16 nM and 2.7 nM for MCH-1R and MCH-2R.
Reference: HY-P1483
€0.00
(tax incl.)
Urotensin II, mouse is an endogenous ligand for the orphan G-protein-coupled receptor GPR14 or SENR. Urotensin II, mouse is a potent vasoconstrictor. Urotensin II, mouse plays a physiological role in the central...
Reference: HY-P2311
€0.00
(tax incl.)
Defensin HNP-2 human is an endogenous antibiotic peptide and monocyte chemotactic peptide produced by human neutrophils.
Reference: HY-P1860
€0.00
(tax incl.)
TNF-α (31-45), human is a peptide of tumor necrosis factor-α.
Reference: HY-118349
€0.00
(tax incl.)
Dansylphenylalanine is a phenylalanine derivative.
Reference: HY-W011324
€0.00
(tax incl.)
(S)-2-((tert-Butoxycarbonyl)amino)-4-(cyclohexyloxy)-4-oxobutanoic acid is an aspartic acid derivative.
Reference: HY-P0329
€0.00
(tax incl.)
X-press Tag Peptide is a tag peptide used for protein purification. X-press Tag is also an N-terminal leader peptide; this N-terminal peptide contains a polyhistidine sequence, the Xpress epitope (part of...
Reference: HY-P3901
€0.00
(tax incl.)
[Leu8,D-Trp22,Tyr25] Somatostatin-28 is the analog of Somatostatin-28. Somatostatin-28 is a intestinal peptide containing somatostatin in its C-terminal portion.
Reference: HY-P2397
€0.00
(tax incl.)
Fmoc-Asn(Trt)-Thr(psi(Me,Me)pro)-OH is a dipeptide.
Reference: HY-P3968
€0.00
(tax incl.)
Thrombospondin-1 (1016-1021) (human, bovine, mouse), a Thrombospondin-1-derived peptide, is a truncated peptide devoid of CD47-binding activity.
Reference: HY-P1965
€0.00
(tax incl.)
Ac-IEVDIDV TFA is a short peptide sequence with Ac at the end.
Reference: HY-P2292A
€0.00
(tax incl.)
Omiganan-FITC TFA is a peptide-FITC complex composed of Omiganan and a FITC. Omiganan is a bactericidal and fungicidal cationic peptide being developed as a topical gel for prevention of catheter-associated infections.
Reference: HY-P1792A
€0.00
(tax incl.)
Angiotensin II (1-4), human (TFA) is an endogenous peptide produced from AT I by angiotensin-converting-enzyme (ACE). Angiotensin II binds the AT II type 1 (AT1) receptor, stimulating GPCRs in vascular smooth muscle...
Reference: HY-P2522
€0.00
(tax incl.)
Competence-Stimulating Peptide-2 (CSP-2) is a quorum sensing signal peptide produced by Streptococcus pneumoniae. ComD2 is a compatible receptor of Competence-Stimulating Peptide-2 (CSP-2) with an EC50 value of 50.7 nM.
Reference: HY-W013824
€0.00
(tax incl.)
Boc-D-Phe(3,4-DiF)-OH is a phenylalanine derivative.
Reference: HY-20861
€0.00
(tax incl.)
(R)-2-amino-3-cyclobutylpropanoic acid is an alanine derivative.
Reference: HY-P3278A
€0.00
(tax incl.)
Caloxin 2A1 TFA is an extracellular plasma membrane Ca2+-ATPase (PMCA) peptide inhibitor. Caloxin 2A1 TFA does not affect basal Mg2+-ATPase or Na+-K+-ATPase.
Reference: HY-34597
€0.00
(tax incl.)
(S)-2-Amino-3-(4-bromophenyl)propanoic acid is a phenylalanine derivative.
Reference: HY-P1924
€0.00
(tax incl.)
Interphotoreceptor retinoid-binding protein(668-687), the amino acid residues 668 to 687 of human interphotoreceptor retinoid binding protein (IRBP), induces uveitis.
Reference: HY-P2148
€0.00
(tax incl.)
P-113 is an antimicrobial peptide (AMP) derived from the human salivary protein histatin 5. P-113 is active against clinically important microorganisms such as Pseudomonas spp., Staphylococcus spp., and C. albicans.
Reference: HY-P1568
€0.00
(tax incl.)
Flagelin 22 (Flagellin 22), a fragment of bacterial flagellin, is an effective elicitor in both plants and algae.
Reference: HY-P2454
€0.00
(tax incl.)
CSP1 is a potent and selective ComD1 receptor agonist, with an IC50 of 10.3 nM. CSP1 is a major variants of competence-stimulating peptide (CSP), and it can regulate genetic transformation of S. pneumonia by...
Reference: HY-P1231
€0.00
(tax incl.)
GTFTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is an Exendin-4 peptide derivative.
Reference: HY-P1210A
€0.00
(tax incl.)
Lys-γ3-MSH(human) TFA is a melanocortin peptide derived from the C-terminal of the fragment of pro-opiomelanocortin (POMC). Lys-γ3-MSH(human) TFA potentiates the steroidogenic response of the rat adrenal to...
Reference: HY-P1390A
€0.00
(tax incl.)
d[Cha4]-AVP TFA is a potent and selective vasopressin (AVP) V1b receptor agonist with a Ki of 1.2 nM for human V1b receptor. d[Cha4]-AVP TFA shows more selective for V1b receptor than human V1a receptor, V2 receptor,...
Reference: HY-W008688
€0.00
(tax incl.)
Fmoc-L-Norleucine is a leucine derivative.
Reference: HY-W052310
€0.00
(tax incl.)
Methyl ((benzyloxy)carbonyl)-D-serinate is a serine derivative.
Reference: HY-P1844A
€0.00
(tax incl.)
Chemerin-9 (149-157) TFA is a potent agonist of chemokine-like receptor 1 (CMKLR1) . Chemerin-9 (149-157) TFA has anti-inflammatory activity. Chemerin-9 (149-157) TFA stimulates phosphorylation of Akt and ERK as well...
Reference: HY-P3591
€0.00
(tax incl.)
YMRF-NH2 is a neuropeptide. YMRF-NH2 binds to FMRFa-R with an EC50 value of 31 nM.
Reference: HY-P1428A
€0.00
(tax incl.)
RFRP-1(human) TFA is a potent endogenous NPFF receptor agonist (EC50 values are 0.0011 and 29 nM for NPFF2 and NPFF1, respectively). Attenuates contractile function of isolated rat and rabbit cardiac myocytes. Reduces...
Reference: HY-W048701
€0.00
(tax incl.)
(((9H-Fluoren-9-yl)methoxy)carbonyl)-D-histidine is a histidine derivative.
Reference: HY-P3743
€0.00
(tax incl.)
p60c-src Substrate is an efficient and specific substrate for p60c-src protein tyrosine kinase (PTK). p60c-src Substrate can be used to synthesize chimeric branched peptides.
Reference: HY-P1574
€0.00
(tax incl.)
[Arg8]-Vasotocin is a vertebrate neurohypophyseal peptide of the vasopressin/oxytocin hormone family.
Reference: HY-P3609
€0.00
(tax incl.)
CR 665 (JNJ 38488502) is a peripherally selective κ-opioid agonist. CR 665 can activate the kappa opioid receptor with EC50 value of 10.9 nM. CR 665 can be used for the research of peripheral pain.
Reference: HY-P2530
€0.00
(tax incl.)
KALA is an amphiphilic peptide that forms an α-helical structure at physiological pH. KALA modifies a plasmid DNA-encapsulating liposomal membrane and is used as a fusogenic peptide in order to achieve effective liver...
Reference: HY-W040416
€0.00
(tax incl.)
(S)-2-(((Benzyloxy)carbonyl)amino)pent-4-enoic acid is a Glycine (HY-Y0966) derivative.
Reference: HY-P0002A
€0.00
(tax incl.)
Protirelin Acetate is a highly conserved neuropeptide that exerts the hormonal control of thyroid-stimulating hormone (TSH) levels as well as neuromodulatory functions.
Reference: HY-P0215A
€0.00
(tax incl.)
Autocamtide-2-related inhibitory peptide, myristoylated TFA is the myristoylated Autocamtide-2-related inhibitory peptide. Autocamtide-2-related inhibitory peptide is a highly specific and potent inhibitor of CaMKII...
Reference: HY-P3204
€0.00
(tax incl.)
POT-4 (AL-78898A), a Compstatin derivative, is a potent inhibitor of complement factor C3 activation. POT-4 can be used for age-related macular degeneration research
Reference: HY-106262B
€0.00
(tax incl.)
Delcasertib (KAI-9803) hydrochloride is a potent and selective δ-protein kinase C (δPKC) inhibitor. Delcasertib (KAI-9803) hydrochloride could ameliorate injury associated with ischemia and reperfusion in animal...
Reference: HY-P2502
€0.00
(tax incl.)
Hepatitis Virus C NS3 Protease Inhibitor 2 is a product-based peptide inhibitor of hepatitis C virus (HCV) NS3 protease, with a Ki of 41 nM.
Reference: HY-W009913
€0.00
(tax incl.)
2-((Carboxymethyl)amino)benzoic acid is a Glycine (HY-Y0966) derivative.
Reference: HY-P1493
€0.00
(tax incl.)
Fibrinopeptide B, human is a 14-aa peptide, released from the amino-terminus of β-chains of fibrinogen by thrombin.
Reference: HY-P3725
€0.00
(tax incl.)
H-Leu-Ser-Phe(NO2)-Nle-Ala-OMe TFA is a substrate for chymosin.
Reference: HY-W091734
€0.00
(tax incl.)
Methyl 4-iodo-L-phenylalaninate hydrochloride is a Phenylalaninate derivative. Methyl 4-iodo-L-phenylalaninate hydrochloride can be used for the preparation of factor XI modulators used in the research of thrombotic...