Category: Proteins & Peptides

Filter By
Brand: Abbexa Brand: Cayman Chemical Brand: FineTest Brand: MedChemExpress  Categories: Peptides Clear all
Fmoc-D-Glu(OtBu)-OH Fmoc-D-Glu(OtBu)-OH

Fmoc-D-Glu(OtBu)-OH

Reference: HY-Y1844
€0.00 (tax incl.)
Fmoc-D-Glu(OtBu)-OH is a glutamic acid derivative.
Mast cell degranulating peptide (28-49) Mast cell degranulating peptide (28-49)

Mast cell degranulating peptide (28-49)

Reference: HY-P1987
€0.00 (tax incl.)
Mast cell degranulating peptide (28-49) is a depolarizing agent from bee venom, it can raise the content of cGMP level in mouse cerebellar slices.
H-Asp(Obzl)-OtBu.HCl H-Asp(Obzl)-OtBu.HCl

H-Asp(Obzl)-OtBu.HCl

Reference: HY-W041996
€0.00 (tax incl.)
H-Asp(Obzl)-OtBu.HCl is an aspartic acid derivative.
Xenopsin-Related Peptide 2 Xenopsin-Related Peptide 2

Xenopsin-Related Peptide 2

Reference: HY-P3837
€0.00 (tax incl.)
Xenopsin-Related Peptide 2 (XP-2) is an avian counterpart to amphibian Xenopsin (HY-P0253). Xenopsin-Related Peptide 2 displays abilities to release histamine from isolated rat mast cells and is as effective as...
H-Asp(Oet)-OEt.HCl H-Asp(Oet)-OEt.HCl

H-Asp(Oet)-OEt.HCl

Reference: HY-W008787
€0.00 (tax incl.)
H-Asp(Oet)-OEt.HCl is an aspartic acid derivative.
[Sar1, Ile8]-Angiotensin II [Sar1, Ile8]-Angiotensin II

[Sar1, Ile8]-Angiotensin II

Reference: HY-P1564
€0.00 (tax incl.)
[Sar1, Ile8]-Angiotensin II is a peptide that has multiple effects on vascular smooth muscle, including contraction of normal arteries and hypertrophy or hyperplasia of cultured cells or diseased vessels.
Casein Kinase II Receptor Peptide Casein Kinase II Receptor Peptide

Casein Kinase II Receptor Peptide

Reference: HY-P3748
€0.00 (tax incl.)
Casein Kinase II Receptor Peptide is a substrate for casein kinase II with an Km value of 500 µM. Casein Kinase II Substrate can be used for measure casein kinase II activity in crude enzyme preparations.
Insulin peglispro Insulin peglispro

Insulin peglispro

Reference: HY-P4062
€0.00 (tax incl.)
Insulin peglispro (BIL) is a basal insulin with a flat, prolonged activity profile. Insulin peglispro can exhibit better glycaemic control compared to conventional insulins.
β-Amyloid (1-43)(human) TFA β-Amyloid (1-43)(human) TFA

β-Amyloid (1-43)(human) TFA

Reference: HY-P1378A
€0.00 (tax incl.)
β-Amyloid (1-43)(human) TFA is more prone to aggregation and has higher toxic properties than the long-known Aβ1-42. β-Amyloid (1-43)(human) TFA shows a correlation with both sAPPα and sAPPβ. β-Amyloid (1-43)(human)...
Tyroserleutide hydrochloride Tyroserleutide hydrochloride

Tyroserleutide hydrochloride

Reference: HY-106263B
€0.00 (tax incl.)
Tyroserleutide hydrochloride, isolated from the degradation products of porcine spleen, is a small molecular tripeptide which inhibits tumor growth both in vitro and in vivo.
Compstatin control peptide Compstatin control peptide

Compstatin control peptide

Reference: HY-P1398
€0.00 (tax incl.)
Compstatin control peptide is a negative control of Compstatin (HY-P1036). Compstatin is a potent complement system C3 inhibitor.
Sincalide Sincalide

Sincalide

Reference: HY-P0093
€0.00 (tax incl.)
Sincalide (Cholecystokinin octapeptide, CCK‐8) is a rapid-acting amino acid polypeptide hormone analogue of cholecystokinin (CCK) for intravenous use in postevacuation cholecystography. CCK‐8 is a major bioactive...
CMD178 TFA CMD178 TFA

CMD178 TFA

Reference: HY-P1453A
€0.00 (tax incl.)
CMD178 TFA is a lead peptide that consistently reduced the expression of Foxp3 and STAT5 induced by IL-2/s IL-2Rα signaling and inhibits Treg cell development.
Fetuin, Fetal Bovine Serum Fetuin, Fetal Bovine Serum

Fetuin, Fetal Bovine Serum

Reference: HY-P2352
€0.00 (tax incl.)
Fetuin, Fetal Bovine Serum is a liver-secreted 64 kDa plasma glycoprotein isolated from fetal bovine serum. Fetuin, Fetal Bovine Serum inhibits trypsin activity and promote cellular attachment, growth, and...
SPACE peptide SPACE peptide

SPACE peptide

Reference: HY-P0123
€0.00 (tax incl.)
SPACE peptide is a skin penetrating peptide (SPPs). SPACE peptide can enhance topical delivery of a macromolecule, hyaluronic acid.
Renin substrate 1 Renin substrate 1

Renin substrate 1

Reference: HY-P3878
€0.00 (tax incl.)
Renin substrate 1 is a renin substrate with high affinity to the enzyme.
2-Furoyl-LIGRLO-amide 2-Furoyl-LIGRLO-amide

2-Furoyl-LIGRLO-amide

Reference: HY-P1314
€0.00 (tax incl.)
2-Furoyl-LIGRLO-amide is a potent and selective proteinase-activated receptor 2 (PAR2) agonist with a pD2 value of 7.0..
Boc-Gly-Gly-Phe-Gly-OH Boc-Gly-Gly-Phe-Gly-OH

Boc-Gly-Gly-Phe-Gly-OH

Reference: HY-P1449
€0.00 (tax incl.)
Boc-Gly-Gly-Phe-Gly-OH, a self-assembly of N- and C-protected tetrapeptide, is a protease cleavable linker used for the antibody-drug conjugate (ADC).
CALP2 TFA CALP2 TFA

CALP2 TFA

Reference: HY-P1076A
€0.00 (tax incl.)
CALP2 TFA is a calmodulin (CaM) antagonist (Kd of 7.9 µM) with high affinity for binding to the CaM EF-hand/Ca2+-binding site. CALP2 TFA inhibits CaM-dependent phosphodiesterase activity and increases intracellular...
Boc-D-3-Pal-OH Boc-D-3-Pal-OH

Boc-D-3-Pal-OH

Reference: HY-W013874
€0.00 (tax incl.)
Boc-D-3-Pal-OH is an alanine derivative.
Secretin (swine) Secretin (swine)

Secretin (swine)

Reference: HY-109538
€0.00 (tax incl.)
Secretin (swine), a neuroendocrine hormone, is the first hormone to be identifie and is secreted by S cells that are localized primarily in the mucosa of the duodenum. Secretin also is a 27-amino acid peptide, which...
Anti-BetaGamma Anti-BetaGamma

Anti-BetaGamma

Reference: HY-P4074
€0.00 (tax incl.)
Anti-BetaGamma, a peptide, is MPS-Phosducin-like protein C terminus.
c(Bua-Cpa-Thi-Val-Asn-Cys)-Pro-Agm c(Bua-Cpa-Thi-Val-Asn-Cys)-Pro-Agm

c(Bua-Cpa-Thi-Val-Asn-Cys)-Pro-Agm

Reference: HY-P1810
€0.00 (tax incl.)
c(Bua-Cpa-Thi-Val-Asn-Cys)-Pro-Agm is a is a potent, selective and short-acting peptidic V2 receptor (V2R) agonist with EC50s of 0.25 and 0.05 nM for hV2R and rV2R, respectively.
CEF7, Influenza Virus NP (380-388) CEF7, Influenza Virus NP (380-388)

CEF7, Influenza Virus NP (380-388)

Reference: HY-P1857
€0.00 (tax incl.)
CEF7, Influenza Virus NP (380-388) is a HLA-B*08 restricted influenza virus nucleoprotein epitope. Influenza virus NP functions as a key adapter molecule between virus and host cell processes.
Iseganan Iseganan

Iseganan

Reference: HY-P3512
€0.00 (tax incl.)
Iseganan is an antimicrobial peptide, shows broad-spectrum anti-bacteria and fungi activity. Iseganan can be used in oral mucositis research.
CTAP CTAP

CTAP

Reference: HY-P1335
€0.00 (tax incl.)
CTAP is a potent, highly selective, and BBB penetrant μ opioid receptor antagonist, with an IC50 of 3.5 nM. CTAP displays over 1200-fold selectivity over δ opioid (IC50=4500 nM) and somatostatin receptors. CTAP can be...
L-JNKI-1 L-JNKI-1

L-JNKI-1

Reference: HY-P0069A
€0.00 (tax incl.)
L-JNKI-1 is a cell-permeable peptide inhibitor specific for JNK.
Peptide YY (PYY) (3-36), porcine TFA Peptide YY (PYY) (3-36), porcine TFA

Peptide YY (PYY) (3-36), porcine TFA

Reference: HY-P1021A
€0.00 (tax incl.)
Peptide YY (PYY) (3-36), porcine TFA is a gut hormone peptide that acts as a Y2 receptor agonist to reduce appetite.
BIO-11006 acetate BIO-11006 acetate

BIO-11006 acetate

Reference: HY-106377A
€0.00 (tax incl.)
BIO-11006 acetate, an analog of the MANS peptide, is a MARCKS (myristoylated alanine-rich C kinase substrate) inhibitor.
β-Amyloid (22-35) β-Amyloid (22-35)

β-Amyloid (22-35)

Reference: HY-P1474
€0.00 (tax incl.)
β-Amyloid 22-35 (Amyloid β-Protein 22-35), the residues 22-35 fragment ofβ-amyloid protein, has a cytotoxic effect on cultured neurons from the rat hippocampus in serum-free medium. β-Amyloid 22-35 forms aggregates...
NoxA1ds TFA NoxA1ds TFA

NoxA1ds TFA

Reference: HY-P1435A
€0.00 (tax incl.)
NoxA1ds TFA is a potent and selective NADPH oxidase 1 (NOX1) inhibitor (IC50=20 nM). NoxA1ds TFA exhibits selectivity for NOX1 over NOX2, NOX4, NOX5 and xanthine oxidase. NoxA1ds TFA inhibits NOX1-derived O2-...
sGnRH-A acetate sGnRH-A acetate

sGnRH-A acetate

Reference: HY-P3582A
€0.00 (tax incl.)
sGnRH-A acetate is a salmon gonadotropin-releasing hormone (GnRH) analogue. sGnRH-A acetate stimulates growth hormone secretion. sGnRH-A acetate also can be used as an inducer of ovulation by artificial insemination.
Ezatiostat Ezatiostat

Ezatiostat

Reference: HY-13634A
€0.00 (tax incl.)
Ezatiostat (TER199 free base; TLK199) is a tripeptide analog of glutathione and is a selective and orally active glutathione S-transferase P1-1 (GSTP1) inhibitor. Ezatiostat leads to JNK activation by inhibiting...
PL-017 TFA PL-017 TFA

PL-017 TFA

Reference: HY-P1338A
€0.00 (tax incl.)
PL-017 TFA is a potent and selective μ opioid receptor agonist with an IC50 of 5.5 nM for 125I-FK 33,824 binding to μ site. PL-017 TFA produces long-lasting, reversible analgesia in rats.
Z-Val-Ala-OH Z-Val-Ala-OH

Z-Val-Ala-OH

Reference: HY-42709
€0.00 (tax incl.)
Z-Val-Ala-OH is a dipeptide derivative of valine and alanine.
WL12 WL12

WL12

Reference: HY-P3440
€0.00 (tax incl.)
WL12 is a specifically targeting programmed death ligand 1 (PD-L1) binding peptide. WL12 can be radiolabeled by different radionuclides, generating radiotracers, which can assess the tumor PD-L1 expression.
N-(4-Nitrobenzoyl)glycine N-(4-Nitrobenzoyl)glycine

N-(4-Nitrobenzoyl)glycine

Reference: HY-W028991
€0.00 (tax incl.)
N-(4-Nitrobenzoyl)glycine is a Glycine (HY-Y0966) derivative.
Biotin-NeurokininA Biotin-NeurokininA

Biotin-NeurokininA

Reference: HY-P3861
€0.00 (tax incl.)
Biotin-NeurokininA is a biotinylated NeurokininA (HY-P0197). Neurokinin A (Substance K), a peptide neurotransmitter of the tachykinin family, acts via the NK-2 receptor. Neurokinin A acts as a major mediator in human...
Acetyl Gastric Inhibitory Peptide (human) Acetyl Gastric Inhibitory Peptide (human)

Acetyl Gastric Inhibitory Peptide (human)

Reference: HY-P3580
€0.00 (tax incl.)
Acetyl Gastric Inhibitory Peptide (human) is a fatty acid derivatized analog of glucose-dependent insulinotropic polypeptide with improved antihyperglycaemic and insulinotropic properties. Acetyl Gastric Inhibitory...
VKGILS-NH2 VKGILS-NH2

VKGILS-NH2

Reference: HY-P1310
€0.00 (tax incl.)
VKGILS-NH2 is a reversed amino acid sequence control peptide for SLIGKV-NH2 (protease-activated receptor 2 (PAR2) agonist). VKGILS-NH2 has no effect on DNA synthesis in cells.
Prolactin Releasing Peptide (12-31), human Prolactin Releasing Peptide (12-31), human

Prolactin Releasing Peptide (12-31), human

Reference: HY-P1530
€0.00 (tax incl.)
Prolactin Releasing Peptide (12-31), human is a fragment of the prolactin releasing peptide (PrRP). Prolactin Releasing Peptide (1-31), human is a high affinity GPR10 ligand that cause the release of the prolactin.
PKG inhibitor peptide TFA PKG inhibitor peptide TFA

PKG inhibitor peptide TFA

Reference: HY-P1292A
€0.00 (tax incl.)
PKG inhibitor peptide TFA is an ATP-competitive inhibitor of cGMP-dependent protein kinase (PKG), with a Ki of 86 μM.
α-Conotoxin PIA TFA α-Conotoxin PIA TFA

α-Conotoxin PIA TFA

Reference: HY-P1268A
€0.00 (tax incl.)
α-Conotoxin PIA TFA is a nicotinic acetylcholine receptor (nAChR) antagonist that targets nAChR subtypes containing α6 and α3 subunits. α-Conotoxin PIA has the potential for the research of Parkinson’s disease, and...
H-His(1-Me)-OMe H-His(1-Me)-OMe

H-His(1-Me)-OMe

Reference: HY-W016330
€0.00 (tax incl.)
H-His(1-Me)-OMe is a histidine derivative that can be used for amino acid synthesis.
OVA Peptide(257-264) TFA OVA Peptide(257-264) TFA

OVA Peptide(257-264) TFA

Reference: HY-P1489A
€0.00 (tax incl.)
OVA Peptide(257-264) TFA is a class I (Kb)-restricted peptide epitope of OVA, an octameric peptide can be from ovalbumin presented by the class I MHC molecule, H-2Kb.
Endothelin 1 (swine, human), Alexa Fluor 488-labeled Endothelin 1 (swine, human), Alexa Fluor 488-labeled

Endothelin 1 (swine, human), Alexa Fluor 488-labeled

Reference: HY-P2496
€0.00 (tax incl.)
Endothelin 1 (swine, human), Alexa Fluor 488-labeled is a synthetic Endothelin 1 peptide labled with Alexa Fluor 488. Endothelin 1 (swine, human) is a synthetic peptide with the sequence of human and swine Endothelin...
Neuromedin S(rat) Neuromedin S(rat)

Neuromedin S(rat)

Reference: HY-P1239
€0.00 (tax incl.)
Neuromedin S(rat) is a 34-amino acids peptide from rat Neuromedin S. Neuromedin S is a neuropeptide isolated from rat brain. Neuromedin S acts as a ligand for the G protein-coupled receptor FM4/TGR-1
Ala-Gly-Ala Ala-Gly-Ala

Ala-Gly-Ala

Reference: HY-P4242
€0.00 (tax incl.)
Ala-Gly-Ala is a prototype of a general tripeptide Xxx-Gly-Zzz. Except glycine and proline, there can be 18 possible amino acids for Xxx and another 18 amino acids for Zzz. Ala-Gly-Ala can be used as a model for up to...
Jagged-1 (188-204) Jagged-1 (188-204)

Jagged-1 (188-204)

Reference: HY-P1846
€0.00 (tax incl.)
Jagged-1 (188-204) is a fragment of the Jagged-1 (JAG-1) protein with Notch agonist activity. JAG-1 is a Notch ligand highly expressed in cultured and primary multiple myeloma (MM) cells. JAG-1 induces maturation of...
H-ILE-ARG-VAL-VAL-MET-OH H-ILE-ARG-VAL-VAL-MET-OH

H-ILE-ARG-VAL-VAL-MET-OH

Reference: HY-P3972
€0.00 (tax incl.)
H-ILE-ARG-VAL-VAL-MET-OH is a pentapeptide from C7 with a domain that supports cell attachment. H-ILE-ARG-VAL-VAL-MET-OH is also the sequence fragment that binds to the thrombospondin-1 (TS1) receptor.
GHGVYGHGVYGHGPYGHGPYGHGLYW GHGVYGHGVYGHGPYGHGPYGHGLYW

GHGVYGHGVYGHGPYGHGPYGHGLYW

Reference: HY-P3401
€0.00 (tax incl.)
GHGVYGHGVYGHGPYGHGPYGHGLYW (DgHBP-2) is 26-amino-acid-long consensus peptide derived from histidine-rich beak protein-2 (DgHBP-2). GHGVYGHGVYGHGPYGHGPYGHGLYW can be used fabricated glucose-responsive insulin delivery...
Z-D-Phg-OH Z-D-Phg-OH

Z-D-Phg-OH

Reference: HY-75332
€0.00 (tax incl.)
Z-D-Phg-OH (D-Cbz phenylglycine) is a N-blocked amino acids with Kd values of 390 μM and 323 μM for tBuCQN and tBuCQD, respectively.
GIP (3-42), human GIP (3-42), human

GIP (3-42), human

Reference: HY-P2542
€0.00 (tax incl.)
GIP (3-42), human acts as a glucose-dependent insulinotropic polypeptide (GIP) receptor antagonist, moderating the insulin secreting and metabolic actions of GIP in vivo.
Substance P(1-4) Substance P(1-4)

Substance P(1-4)

Reference: HY-P3598
€0.00 (tax incl.)
Substance P(1-4) is a potent neurokinin receptors (NK-R) antagonist. Substance P(1-4) has regulation of normal hematopoiesis and inhibits endogenous erythroid colony (EEC) formation.
NMNNAGDKWSAFLKEQSTLAQMYPLQEIQNLTVKLQLQALQQ NMNNAGDKWSAFLKEQSTLAQMYPLQEIQNLTVKLQLQALQQ

NMNNAGDKWSAFLKEQSTLAQMYPLQEIQNLTVKLQLQALQQ

Reference: HY-P3142
€0.00 (tax incl.)
NMNNAGDKWSAFLKEQSTLAQMYPLQEIQNLTVKLQLQALQQ is an angiotensin-converting enzyme 2 (ACE2) related peptide that can be used as a tool for understanding ACE2 functions.
Fequesetide Fequesetide

Fequesetide

Reference: HY-P2463
€0.00 (tax incl.)
Fequesetide, a peptide segment, is the active site within the protein thymosin β4 responsible for actin binding, cell migration and wound healing.
Adipokinetic hormone (Gryllus bimaculatus) Adipokinetic hormone (Gryllus bimaculatus)

Adipokinetic hormone (Gryllus bimaculatus)

Reference: HY-P3568
€0.00 (tax incl.)
Adipokinetic hormone Gryllus bimaculatus (Grybi-AKH) is an adipokinetic hormone that regulates energy homeostasis in insects by mobilizing lipid and carbohydrate from the fat body. Adipokinetic hormone Gryllus...
Boc-Gly-Gly-OH Boc-Gly-Gly-OH

Boc-Gly-Gly-OH

Reference: HY-W013968
€0.00 (tax incl.)
Boc-Gly-Gly-OH is a Glycine (HY-Y0966) derivative.
Exendin (5-39) Exendin (5-39)

Exendin (5-39)

Reference: HY-P2497
€0.00 (tax incl.)
Exendin (5-39) is a potent glucagon-like peptide 1 (GLP-1) receptor antagonist. Exendin (5-39) improves memory impairment in β-amyloid protein-treated rats.
(Nle4)-α-MSH (Nle4)-α-MSH

(Nle4)-α-MSH

Reference: HY-P3645
€0.00 (tax incl.)
(Nle4)-α-MSH is a synthetic analogue of α-MSH (HY-P0252), a melanocyte-stimulating hormone. (Nle4)-α-MSH reversibly darkens frog skins and also exhibits prolonged activity after heat-alkali treatment.
Arg-Gly-Asp-Ser Arg-Gly-Asp-Ser

Arg-Gly-Asp-Ser

Reference: HY-12290
€0.00 (tax incl.)
Arg-Gly-Asp-Ser is an integrin binding sequence that inhibits integrin receptor function. Arg-Gly-Asp-Ser directly and specifically bind pro-caspase-8, pro-caspase-9 and pro-caspase-3, while it does not bind...
Cyclo(Arg-Gly-Asp-D-Phe-Val) Cyclo(Arg-Gly-Asp-D-Phe-Val)

Cyclo(Arg-Gly-Asp-D-Phe-Val)

Reference: HY-P1613
€0.00 (tax incl.)
Cyclo(Arg-Gly-Asp-D-Phe-Val) is an integrin αvβ3 inhibitor. Cyclo(Arg-Gly-Asp-D-Phe-Val) has antitumor activity. Cyclo(Arg-Gly-Asp-D-Phe-Val) can be used for the research of acute myeloid leukemia.
Mibenratide Mibenratide

Mibenratide

Reference: HY-P3557
€0.00 (tax incl.)
Mibenratide, a small cyclic peptide, is an adrenergic β1 receptor antagonist. Mibenratide can be used for heart failure research.
Neuropeptide EI, rat Neuropeptide EI, rat

Neuropeptide EI, rat

Reference: HY-P1869
€0.00 (tax incl.)
Neuropeptide EI, rat displays functional melanin concentrating hormone (MCH)-antagonist and melanocyte-stimulating hormone (MSH) agonist activity in different behavioral paradigms.
Ac-D-Ala-OH Ac-D-Ala-OH

Ac-D-Ala-OH

Reference: HY-W012713
€0.00 (tax incl.)
Ac-D-Ala-OH is an alanine derivative.
CAP 37 (20-44) CAP 37 (20-44)

CAP 37 (20-44)

Reference: HY-P3911
€0.00 (tax incl.)
CAP 37 (20-44) is a peptide based on amino acid residues 20 through 44 of CAP37. CAP37, a Cationic antimicrobial protein of 37 kDa, is a multifunctional protein.
FSLLRY-NH2 FSLLRY-NH2

FSLLRY-NH2

Reference: HY-P1260
€0.00 (tax incl.)
FSLLRY-NH2 is a protease-activated receptor 2 (PAR2) inhibitor.
Teduglutide Teduglutide

Teduglutide

Reference: HY-P1624
€0.00 (tax incl.)
Teduglutide is a dipeptidyl peptidase IV resistant glucagon-like peptide 2 (GLP-2) analogue. Teduglutide is associated with trophic effects on gut mucosa. Teduglutide can be used for the research of short bowel...
(Gly22)-Amyloid β-Protein (1-42) (Gly22)-Amyloid β-Protein (1-42)

(Gly22)-Amyloid β-Protein (1-42)

Reference: HY-P3845
€0.00 (tax incl.)
(Gly22)-Amyloid β-Protein (1-42) is a peptide fragment of amyloid β-protein (Aβ). Amyloid β-protein is the primary component of both vascular and parenchymal amyloid deposits in Alzheimer's disease. Mutation of Glu22...
H-Gly-OBzl.TosOH H-Gly-OBzl.TosOH

H-Gly-OBzl.TosOH

Reference: HY-W011200
€0.00 (tax incl.)
H-Gly-OBzl.TosOH is a Glycine (HY-Y0966) derivative.
trans-N-Methyl-4-methoxyproline trans-N-Methyl-4-methoxyproline

trans-N-Methyl-4-methoxyproline

Reference: HY-W065053
€0.00 (tax incl.)
trans-N-Methyl-4-methoxyproline is a natural product that can be isolated from the stems of Petiveria alliacea and is also a Proline derivative.
FFAGLDD FFAGLDD

FFAGLDD

Reference: HY-P2004
€0.00 (tax incl.)
FFAGLDD is MMP9 selective cleavage peptides, which used for cytosolic delivery of Doxorubi-cin (DOX) and achieve temporally and spatially controlled slow drug delivery and release.
Fmoc-Asp(OcHex)-OH Fmoc-Asp(OcHex)-OH

Fmoc-Asp(OcHex)-OH

Reference: HY-W013659
€0.00 (tax incl.)
Fmoc-Asp(OcHex)-OH is an aspartic acid derivative.
α-Helical CRF(9-41) TFA α-Helical CRF(9-41) TFA

α-Helical CRF(9-41) TFA

Reference: HY-P1294A
€0.00 (tax incl.)
α-Helical CRF(9-41) TFA is a competitive CRF2 receptor antagonist with KB of ~100 nM. α-Helical CRF(9-41) TFA is also a partial agonist of CRF1 receptor with an EC50 of 140 nM.
Z-Ser-OH Z-Ser-OH

Z-Ser-OH

Reference: HY-W007842
€0.00 (tax incl.)
Z-Ser-OH is a serine derivative.
KGDS KGDS

KGDS

Reference: HY-P3523
€0.00 (tax incl.)
KGDS is synthetic peptides, targeting integrin GPIIb-IIIa located on the membrane of human activated platelets. Amino acid sequence: Lys-Gly-Asp-Ser.
Fmoc-Cpa-OH Fmoc-Cpa-OH

Fmoc-Cpa-OH

Reference: HY-W041983
€0.00 (tax incl.)
Fmoc-Cpa-OH is a compound containing both an amino group and a carboxyl group.
Forigerimod Forigerimod

Forigerimod

Reference: HY-105037
€0.00 (tax incl.)
Forigerimod (IPP-201101) is a CD4 T-cell modulator. Forigerimod is a 21-amino-acid fragment of U1 small nuclear ribonucleoprotein 70 kDa that is phosphorylated at Ser140. Forigerimod can potently inhibit autophagy....
[Asu1,6]-Oxytocin [Asu1,6]-Oxytocin

[Asu1,6]-Oxytocin

Reference: HY-P3866
€0.00 (tax incl.)
[Asu1,6]-Oxytocin is an analog of oxytocin. [Asu1,6]-Oxytocin reverses insulin resistance and glucose intolerance prior to reduction of obesity. [Asu1,6]-Oxytocin has the potential for the research of obesity and...

Menu

Settings

Please sign in first.

Sign in