Category: Proteins & Peptides

Filter By
Brand: Agrisera Brand: ApexBio Brand: Cayman Chemical Brand: PromoCell Clear all
PAF Acetylhydrolase Blocking Peptide PAF Acetylhydrolase Blocking Peptide

PAF Acetylhydrolase Blocking Peptide

Reference: 360603-200
€0.00 (tax incl.)
Peptide Sequence: human C-terminal amino acids 420-441 (TNINTTNQHIMLQNSSGIEKYN)(2618) · To be used in conjunction with Cayman’s PAF-AH polyclonal antiserum (Catalog No. 160603) to block protein-antibody complex...
15-hydroxy Prostaglandin Dehydrogenase Blocking Peptide 15-hydroxy Prostaglandin Dehydrogenase Blocking Peptide

15-hydroxy Prostaglandin Dehydrogenase Blocking Peptide

Reference: 360615-200
€0.00 (tax incl.)
Peptide Sequence: amino acids 92-105 (AGVNNEKNWEKTLQ) from the human NAD+-dependent 15-hydroxy PGDH(387) · To be used in conjunction with Cayman’s 15-hydroxy PGDH polyclonal antibody (Catalog No. 160615) to block...
Prostaglandin I Synthase Blocking Peptide Prostaglandin I Synthase Blocking Peptide

Prostaglandin I Synthase Blocking Peptide

Reference: 360640-200
€0.00 (tax incl.)
Peptide Sequence: bovine amino acids 299-329 (LLKNPEALAAVRGELETVLLGAEQPISQMTT)(3477,3476,3478) · To be used in conjunction with Cayman’s PGIS polyclonal antibody (Catalog No. 160640) to block protein-antibody complex...
Thromboxane Synthase Blocking Peptide Thromboxane Synthase Blocking Peptide

Thromboxane Synthase Blocking Peptide

Reference: 360715-200
€0.00 (tax incl.)
Peptide Sequence: human amino acids 359-377 (TNPDCQEKLLREVDVFKEK)(50,4150) · To be used in conjunction with Cayman’s thromboxane synthase polyclonal antibody (Catalog No. 160715) to block protein-antibody complex...
Caspase-3 (human) Blocking Peptide Caspase-3 (human) Blocking Peptide

Caspase-3 (human) Blocking Peptide

Reference: 360745-200
€0.00 (tax incl.)
Peptide Sequence: human caspase-3 sequence amino acids 166-183 (TELDSGIETDSGVDDDMA)(8444) · To be used in conjunction with Cayman’s Caspase-3 (human) Polyclonal Antibody (Catalog No. 160745) to block protein-antibody...
AIF Blocking Peptide AIF Blocking Peptide

AIF Blocking Peptide

Reference: 360773-1
€0.00 (tax incl.)
Peptide Sequence: human AIF amino acids 151-180 (RARDPGARVLIVSEDPELPYMRPPLSKELW) · To be used in conjunction with Cayman’s AIF polyclonal antibody (Catalog No. 160773) to block protein-antibody complex formation...
Apaf-1 Blocking Peptide Apaf-1 Blocking Peptide

Apaf-1 Blocking Peptide

Reference: 360780-200
€0.00 (tax incl.)
Peptide Sequence: human Apaf-1 amino acids 12-28 (HREALEKDIKTSYIMDHC); the sequence of the peptide is identical between human and mouse.(6894,6873) · To be used in conjunction with Cayman’s Apaf-1 polyclonal antibody...
nNOS Blocking Peptide nNOS Blocking Peptide

nNOS Blocking Peptide

Reference: 360871-200
€0.00 (tax incl.)
Peptide Sequence: human nNOS amino acids 1422-1433 (ESKKDTDEVFSS)(1280,4153) · To be used in conjunction with Cayman’s nNOS polyclonal antibody (Catalog No. 160870) to block protein-antibody complex formation during...
eNOS Blocking Peptide eNOS Blocking Peptide

eNOS Blocking Peptide

Reference: 360881-200
€0.00 (tax incl.)
Peptide Sequence: human eNOS amino acids 1186-1203 (RGAVPWAFDPPGSDTNS) · To be used in conjunction with Cayman’s eNOS polyclonal antiserum (Item No. 160880) to block protein-antibody complex formation during analysis...
Guanylate Cyclase α subunit (soluble) Blocking Peptide Guanylate Cyclase α subunit (soluble) Blocking Peptide

Guanylate Cyclase α subunit (soluble) Blocking Peptide

Reference: 360895-200
€0.00 (tax incl.)
Peptide sequences: human guanylate cyclase α subunit amino acids 418-436 (EQARAQDGLKKRLGKLKAT) · To be used in conjunction with Cayman’s guanylate cyclase α subunit polyclonal antibody (Catalog No. 160895) to block...
Guanylate Cyclase β1 subunit (soluble) Blocking Peptide Guanylate Cyclase β1 subunit (soluble) Blocking Peptide

Guanylate Cyclase β1 subunit (soluble) Blocking Peptide

Reference: 360897-200
€0.00 (tax incl.)
Peptide Sequence: soluble rat guanylate cyclase β1 subunit, amino acids 188-207 (EDFYEDLDRFEENGTQDSR; last D=E in human and bovine)(3531,4654,3535) · To be used in conjunction with Cayman’s guanylate cyclase β1...
AtpC | gamma subunit of ATP synthase, blocking peptide AtpC | gamma subunit of ATP synthase, blocking peptide

AtpC | gamma subunit of ATP synthase, blocking peptide

Reference: AS09 312P
€0.00 (tax incl.)
This blocking peptide can be used as a control to neutralize AtpC | gamma subunit of ATP synthase before immunolocalization or western blot. Furter details are provided below.ATP synthase produces ATP from ADP in the...
AGO1 | Argonaute 1, Blocking peptide AGO1 | Argonaute 1, Blocking peptide

AGO1 | Argonaute 1, Blocking peptide

Reference: AS09 527P
€0.00 (tax incl.)
This blocking peptide can be used as a control to neutralize AGO1 | argonaute 1 before immunolocalization or western blot. Furter details are provided below.AGO1 belongs to a group of argonaute proteins which are...
Dehydrin blocking peptide Dehydrin blocking peptide

Dehydrin blocking peptide

Reference: AS10 206S
€0.00 (tax incl.)
Dehydrins are stress proteins involved in formation of plant protective reactions against dehydration. They are normally synthesized in maturating seeds during their dessication, as well as in vegetative tissues of...
Patatin | Blocking peptide Patatin | Blocking peptide

Patatin | Blocking peptide

Reference: AS12 1842P
€0.00 (tax incl.)
This blocking peptide can be used as a control to neutralize Patatin before immunolocalization or western blot. Furter details are provided below.Patatin is the most abundant protein in potato (Solanum tuberosum L.)...
NpHR | Halorhodopsin blocking peptide NpHR | Halorhodopsin blocking peptide

NpHR | Halorhodopsin blocking peptide

Reference: AS12 1851P
€0.00 (tax incl.)
This blocking peptide can be used as a control to neutralize Halorhodopsin before immunolocalization or western blot. Furter details are provided below.Halorhodopsin (HR) is a hyperpolarizing light-driven ion pump...
AHK2 | Histidine kinase 2, Blocking peptide AHK2 | Histidine kinase 2, Blocking peptide

AHK2 | Histidine kinase 2, Blocking peptide

Reference: AS12 2113P
€0.00 (tax incl.)
This blocking peptide can be used as a control to neutralize AHK2 | Histidine kinase 2 before immunolocalization or western blot. Furter details are provided below.AHK2 (Histidine kinase 2) is a cytokinin receptor,...
Streptavidin HRP Conjugated, for ELISA Streptavidin HRP Conjugated, for ELISA

Streptavidin HRP Conjugated, for ELISA

Reference: AS15 2860
€0.00 (tax incl.)
Streptavidin is a protein that has a very high affinity for biotin (known as vitamin B7 or H). The binding of biotin to streptavidin is one of the strongest non-covalent interactions known in nature. Streptavidin is...
GFP | Recombinant GFP protein (wild type) GFP | Recombinant GFP protein (wild type)

GFP | Recombinant GFP protein (wild type)

Reference: AS15 3002
€0.00 (tax incl.)
GFP (Green fluorescent protein) was originally identified in photo organs on jellyfish Aequorea victoria. It is a naturally fluorescent protein which emits green light at a maximum wavelength of 509 nm when excited by...
IAA | Indole 3 acetic acid, BSA conjugated IAA | Indole 3 acetic acid, BSA conjugated

IAA | Indole 3 acetic acid, BSA conjugated

Reference: AS16 3218
€0.00 (tax incl.)
Indole 3 acetic acid (IAA) is the principal auxin in higher plants. This hormone is produced in in cells in the apex and young leaves of a plant. Plant cells synthesize IAA from tryptophan. Different effects caused...
Trans-zeatin tracer (alkaline phospahatase conjugated) Trans-zeatin tracer (alkaline phospahatase conjugated)

Trans-zeatin tracer (alkaline phospahatase conjugated)

Reference: AS16 4090
€0.00 (tax incl.)
Cytokinins (CK) belong to a class of plant growth substances (plant hormones) which promote cell deivision by means of local and long distance signalling.Zeatin is an adenine-type cytokinin synthesised in stems,...
Cis-zeatin tracer (alkaline phospahatase conjugated) Cis-zeatin tracer (alkaline phospahatase conjugated)

Cis-zeatin tracer (alkaline phospahatase conjugated)

Reference: AS16 4092
€0.00 (tax incl.)
Cytokinins (CK) belong to a class of plant growth substances (plant hormones) which promote cell deivision by means of local and long distance signalling. Zeatin is an adenine-type cytokinin synthesised in stems,...
Human Novel Coronavirus Nucleoprotein(N) Human Novel Coronavirus Nucleoprotein(N)

Human Novel Coronavirus Nucleoprotein(N)

Reference: AS20 4388
€0.00 (tax incl.)
Nucleaoprotein (N) of Novel Coronavirus SARS-CoV-2/ 2019-nCoV (human) plays a fundamental role during virion assembly through packaging of the positive strand viral genome RNA into a helical ribonucleocapsid...
Human Novel Coronavirus Nucleoprotein(N) 100 µg Human Novel Coronavirus Nucleoprotein(N) 100 µg

Human Novel Coronavirus Nucleoprotein(N) 100 µg

Reference: AS20 4388-100
€0.00 (tax incl.)
Nucleaoprotein (N) of Novel Coronavirus SARS-CoV-2/ 2019-nCoV (human) plays a fundamental role during virion assembly through packaging of the positive strand viral genome RNA into a helical ribonucleocapsid...
Human Novel Coronavirus Nucleoprotein(N) 1000 µg Human Novel Coronavirus Nucleoprotein(N) 1000 µg

Human Novel Coronavirus Nucleoprotein(N) 1000 µg

Reference: AS20 4388-1000
€0.00 (tax incl.)
Nucleaoprotein (N) of Novel Coronavirus SARS-CoV-2/ 2019-nCoV (human) plays a fundamental role during virion assembly through packaging of the positive strand viral genome RNA into a helical ribonucleocapsid...
Human Novel Coronavirus Spike glycoprotein(S) Human Novel Coronavirus Spike glycoprotein(S)

Human Novel Coronavirus Spike glycoprotein(S)

Reference: AS20 4389
€0.00 (tax incl.)
SARS-CoV-2/ 2019-nCoV S protein of Novel Coronavirus (human) its role is to attache the virion to the cell membrane by interacting with host receptor (ACE2) and initiating the infection. Alternative names: S, S1,...

Menu

Settings

Please sign in first.

Sign in