Category: Proteins & Peptides

Filter By
Brand: Arigo Biolaboratoires Brand: MedChemExpress  Clear all
WL12 WL12

WL12

Reference: HY-P3440
€0.00 (tax incl.)
WL12 is a specifically targeting programmed death ligand 1 (PD-L1) binding peptide. WL12 can be radiolabeled by different radionuclides, generating radiotracers, which can assess the tumor PD-L1 expression.
N-(4-Nitrobenzoyl)glycine N-(4-Nitrobenzoyl)glycine

N-(4-Nitrobenzoyl)glycine

Reference: HY-W028991
€0.00 (tax incl.)
N-(4-Nitrobenzoyl)glycine is a Glycine (HY-Y0966) derivative.
Biotin-NeurokininA Biotin-NeurokininA

Biotin-NeurokininA

Reference: HY-P3861
€0.00 (tax incl.)
Biotin-NeurokininA is a biotinylated NeurokininA (HY-P0197). Neurokinin A (Substance K), a peptide neurotransmitter of the tachykinin family, acts via the NK-2 receptor. Neurokinin A acts as a major mediator in human...
Acetyl Gastric Inhibitory Peptide (human) Acetyl Gastric Inhibitory Peptide (human)

Acetyl Gastric Inhibitory Peptide (human)

Reference: HY-P3580
€0.00 (tax incl.)
Acetyl Gastric Inhibitory Peptide (human) is a fatty acid derivatized analog of glucose-dependent insulinotropic polypeptide with improved antihyperglycaemic and insulinotropic properties. Acetyl Gastric Inhibitory...
VKGILS-NH2 VKGILS-NH2

VKGILS-NH2

Reference: HY-P1310
€0.00 (tax incl.)
VKGILS-NH2 is a reversed amino acid sequence control peptide for SLIGKV-NH2 (protease-activated receptor 2 (PAR2) agonist). VKGILS-NH2 has no effect on DNA synthesis in cells.
Prolactin Releasing Peptide (12-31), human Prolactin Releasing Peptide (12-31), human

Prolactin Releasing Peptide (12-31), human

Reference: HY-P1530
€0.00 (tax incl.)
Prolactin Releasing Peptide (12-31), human is a fragment of the prolactin releasing peptide (PrRP). Prolactin Releasing Peptide (1-31), human is a high affinity GPR10 ligand that cause the release of the prolactin.
PKG inhibitor peptide TFA PKG inhibitor peptide TFA

PKG inhibitor peptide TFA

Reference: HY-P1292A
€0.00 (tax incl.)
PKG inhibitor peptide TFA is an ATP-competitive inhibitor of cGMP-dependent protein kinase (PKG), with a Ki of 86 μM.
α-Conotoxin PIA TFA α-Conotoxin PIA TFA

α-Conotoxin PIA TFA

Reference: HY-P1268A
€0.00 (tax incl.)
α-Conotoxin PIA TFA is a nicotinic acetylcholine receptor (nAChR) antagonist that targets nAChR subtypes containing α6 and α3 subunits. α-Conotoxin PIA has the potential for the research of Parkinson’s disease, and...
H-His(1-Me)-OMe H-His(1-Me)-OMe

H-His(1-Me)-OMe

Reference: HY-W016330
€0.00 (tax incl.)
H-His(1-Me)-OMe is a histidine derivative that can be used for amino acid synthesis.
OVA Peptide(257-264) TFA OVA Peptide(257-264) TFA

OVA Peptide(257-264) TFA

Reference: HY-P1489A
€0.00 (tax incl.)
OVA Peptide(257-264) TFA is a class I (Kb)-restricted peptide epitope of OVA, an octameric peptide can be from ovalbumin presented by the class I MHC molecule, H-2Kb.
Endothelin 1 (swine, human), Alexa Fluor 488-labeled Endothelin 1 (swine, human), Alexa Fluor 488-labeled

Endothelin 1 (swine, human), Alexa Fluor 488-labeled

Reference: HY-P2496
€0.00 (tax incl.)
Endothelin 1 (swine, human), Alexa Fluor 488-labeled is a synthetic Endothelin 1 peptide labled with Alexa Fluor 488. Endothelin 1 (swine, human) is a synthetic peptide with the sequence of human and swine Endothelin...
Neuromedin S(rat) Neuromedin S(rat)

Neuromedin S(rat)

Reference: HY-P1239
€0.00 (tax incl.)
Neuromedin S(rat) is a 34-amino acids peptide from rat Neuromedin S. Neuromedin S is a neuropeptide isolated from rat brain. Neuromedin S acts as a ligand for the G protein-coupled receptor FM4/TGR-1
Ala-Gly-Ala Ala-Gly-Ala

Ala-Gly-Ala

Reference: HY-P4242
€0.00 (tax incl.)
Ala-Gly-Ala is a prototype of a general tripeptide Xxx-Gly-Zzz. Except glycine and proline, there can be 18 possible amino acids for Xxx and another 18 amino acids for Zzz. Ala-Gly-Ala can be used as a model for up to...
Jagged-1 (188-204) Jagged-1 (188-204)

Jagged-1 (188-204)

Reference: HY-P1846
€0.00 (tax incl.)
Jagged-1 (188-204) is a fragment of the Jagged-1 (JAG-1) protein with Notch agonist activity. JAG-1 is a Notch ligand highly expressed in cultured and primary multiple myeloma (MM) cells. JAG-1 induces maturation of...
H-ILE-ARG-VAL-VAL-MET-OH H-ILE-ARG-VAL-VAL-MET-OH

H-ILE-ARG-VAL-VAL-MET-OH

Reference: HY-P3972
€0.00 (tax incl.)
H-ILE-ARG-VAL-VAL-MET-OH is a pentapeptide from C7 with a domain that supports cell attachment. H-ILE-ARG-VAL-VAL-MET-OH is also the sequence fragment that binds to the thrombospondin-1 (TS1) receptor.
GHGVYGHGVYGHGPYGHGPYGHGLYW GHGVYGHGVYGHGPYGHGPYGHGLYW

GHGVYGHGVYGHGPYGHGPYGHGLYW

Reference: HY-P3401
€0.00 (tax incl.)
GHGVYGHGVYGHGPYGHGPYGHGLYW (DgHBP-2) is 26-amino-acid-long consensus peptide derived from histidine-rich beak protein-2 (DgHBP-2). GHGVYGHGVYGHGPYGHGPYGHGLYW can be used fabricated glucose-responsive insulin delivery...
Z-D-Phg-OH Z-D-Phg-OH

Z-D-Phg-OH

Reference: HY-75332
€0.00 (tax incl.)
Z-D-Phg-OH (D-Cbz phenylglycine) is a N-blocked amino acids with Kd values of 390 μM and 323 μM for tBuCQN and tBuCQD, respectively.
GIP (3-42), human GIP (3-42), human

GIP (3-42), human

Reference: HY-P2542
€0.00 (tax incl.)
GIP (3-42), human acts as a glucose-dependent insulinotropic polypeptide (GIP) receptor antagonist, moderating the insulin secreting and metabolic actions of GIP in vivo.
Substance P(1-4) Substance P(1-4)

Substance P(1-4)

Reference: HY-P3598
€0.00 (tax incl.)
Substance P(1-4) is a potent neurokinin receptors (NK-R) antagonist. Substance P(1-4) has regulation of normal hematopoiesis and inhibits endogenous erythroid colony (EEC) formation.
NMNNAGDKWSAFLKEQSTLAQMYPLQEIQNLTVKLQLQALQQ NMNNAGDKWSAFLKEQSTLAQMYPLQEIQNLTVKLQLQALQQ

NMNNAGDKWSAFLKEQSTLAQMYPLQEIQNLTVKLQLQALQQ

Reference: HY-P3142
€0.00 (tax incl.)
NMNNAGDKWSAFLKEQSTLAQMYPLQEIQNLTVKLQLQALQQ is an angiotensin-converting enzyme 2 (ACE2) related peptide that can be used as a tool for understanding ACE2 functions.
Fequesetide Fequesetide

Fequesetide

Reference: HY-P2463
€0.00 (tax incl.)
Fequesetide, a peptide segment, is the active site within the protein thymosin β4 responsible for actin binding, cell migration and wound healing.
Adipokinetic hormone (Gryllus bimaculatus) Adipokinetic hormone (Gryllus bimaculatus)

Adipokinetic hormone (Gryllus bimaculatus)

Reference: HY-P3568
€0.00 (tax incl.)
Adipokinetic hormone Gryllus bimaculatus (Grybi-AKH) is an adipokinetic hormone that regulates energy homeostasis in insects by mobilizing lipid and carbohydrate from the fat body. Adipokinetic hormone Gryllus...
Boc-Gly-Gly-OH Boc-Gly-Gly-OH

Boc-Gly-Gly-OH

Reference: HY-W013968
€0.00 (tax incl.)
Boc-Gly-Gly-OH is a Glycine (HY-Y0966) derivative.
Exendin (5-39) Exendin (5-39)

Exendin (5-39)

Reference: HY-P2497
€0.00 (tax incl.)
Exendin (5-39) is a potent glucagon-like peptide 1 (GLP-1) receptor antagonist. Exendin (5-39) improves memory impairment in β-amyloid protein-treated rats.
(Nle4)-α-MSH (Nle4)-α-MSH

(Nle4)-α-MSH

Reference: HY-P3645
€0.00 (tax incl.)
(Nle4)-α-MSH is a synthetic analogue of α-MSH (HY-P0252), a melanocyte-stimulating hormone. (Nle4)-α-MSH reversibly darkens frog skins and also exhibits prolonged activity after heat-alkali treatment.
Arg-Gly-Asp-Ser Arg-Gly-Asp-Ser

Arg-Gly-Asp-Ser

Reference: HY-12290
€0.00 (tax incl.)
Arg-Gly-Asp-Ser is an integrin binding sequence that inhibits integrin receptor function. Arg-Gly-Asp-Ser directly and specifically bind pro-caspase-8, pro-caspase-9 and pro-caspase-3, while it does not bind...
Cyclo(Arg-Gly-Asp-D-Phe-Val) Cyclo(Arg-Gly-Asp-D-Phe-Val)

Cyclo(Arg-Gly-Asp-D-Phe-Val)

Reference: HY-P1613
€0.00 (tax incl.)
Cyclo(Arg-Gly-Asp-D-Phe-Val) is an integrin αvβ3 inhibitor. Cyclo(Arg-Gly-Asp-D-Phe-Val) has antitumor activity. Cyclo(Arg-Gly-Asp-D-Phe-Val) can be used for the research of acute myeloid leukemia.
Mibenratide Mibenratide

Mibenratide

Reference: HY-P3557
€0.00 (tax incl.)
Mibenratide, a small cyclic peptide, is an adrenergic β1 receptor antagonist. Mibenratide can be used for heart failure research.
Neuropeptide EI, rat Neuropeptide EI, rat

Neuropeptide EI, rat

Reference: HY-P1869
€0.00 (tax incl.)
Neuropeptide EI, rat displays functional melanin concentrating hormone (MCH)-antagonist and melanocyte-stimulating hormone (MSH) agonist activity in different behavioral paradigms.
Ac-D-Ala-OH Ac-D-Ala-OH

Ac-D-Ala-OH

Reference: HY-W012713
€0.00 (tax incl.)
Ac-D-Ala-OH is an alanine derivative.
CAP 37 (20-44) CAP 37 (20-44)

CAP 37 (20-44)

Reference: HY-P3911
€0.00 (tax incl.)
CAP 37 (20-44) is a peptide based on amino acid residues 20 through 44 of CAP37. CAP37, a Cationic antimicrobial protein of 37 kDa, is a multifunctional protein.
FSLLRY-NH2 FSLLRY-NH2

FSLLRY-NH2

Reference: HY-P1260
€0.00 (tax incl.)
FSLLRY-NH2 is a protease-activated receptor 2 (PAR2) inhibitor.
Teduglutide Teduglutide

Teduglutide

Reference: HY-P1624
€0.00 (tax incl.)
Teduglutide is a dipeptidyl peptidase IV resistant glucagon-like peptide 2 (GLP-2) analogue. Teduglutide is associated with trophic effects on gut mucosa. Teduglutide can be used for the research of short bowel...
(Gly22)-Amyloid β-Protein (1-42) (Gly22)-Amyloid β-Protein (1-42)

(Gly22)-Amyloid β-Protein (1-42)

Reference: HY-P3845
€0.00 (tax incl.)
(Gly22)-Amyloid β-Protein (1-42) is a peptide fragment of amyloid β-protein (Aβ). Amyloid β-protein is the primary component of both vascular and parenchymal amyloid deposits in Alzheimer's disease. Mutation of Glu22...
H-Gly-OBzl.TosOH H-Gly-OBzl.TosOH

H-Gly-OBzl.TosOH

Reference: HY-W011200
€0.00 (tax incl.)
H-Gly-OBzl.TosOH is a Glycine (HY-Y0966) derivative.
trans-N-Methyl-4-methoxyproline trans-N-Methyl-4-methoxyproline

trans-N-Methyl-4-methoxyproline

Reference: HY-W065053
€0.00 (tax incl.)
trans-N-Methyl-4-methoxyproline is a natural product that can be isolated from the stems of Petiveria alliacea and is also a Proline derivative.
FFAGLDD FFAGLDD

FFAGLDD

Reference: HY-P2004
€0.00 (tax incl.)
FFAGLDD is MMP9 selective cleavage peptides, which used for cytosolic delivery of Doxorubi-cin (DOX) and achieve temporally and spatially controlled slow drug delivery and release.
Fmoc-Asp(OcHex)-OH Fmoc-Asp(OcHex)-OH

Fmoc-Asp(OcHex)-OH

Reference: HY-W013659
€0.00 (tax incl.)
Fmoc-Asp(OcHex)-OH is an aspartic acid derivative.
α-Helical CRF(9-41) TFA α-Helical CRF(9-41) TFA

α-Helical CRF(9-41) TFA

Reference: HY-P1294A
€0.00 (tax incl.)
α-Helical CRF(9-41) TFA is a competitive CRF2 receptor antagonist with KB of ~100 nM. α-Helical CRF(9-41) TFA is also a partial agonist of CRF1 receptor with an EC50 of 140 nM.
Z-Ser-OH Z-Ser-OH

Z-Ser-OH

Reference: HY-W007842
€0.00 (tax incl.)
Z-Ser-OH is a serine derivative.
KGDS KGDS

KGDS

Reference: HY-P3523
€0.00 (tax incl.)
KGDS is synthetic peptides, targeting integrin GPIIb-IIIa located on the membrane of human activated platelets. Amino acid sequence: Lys-Gly-Asp-Ser.
Fmoc-Cpa-OH Fmoc-Cpa-OH

Fmoc-Cpa-OH

Reference: HY-W041983
€0.00 (tax incl.)
Fmoc-Cpa-OH is a compound containing both an amino group and a carboxyl group.
Forigerimod Forigerimod

Forigerimod

Reference: HY-105037
€0.00 (tax incl.)
Forigerimod (IPP-201101) is a CD4 T-cell modulator. Forigerimod is a 21-amino-acid fragment of U1 small nuclear ribonucleoprotein 70 kDa that is phosphorylated at Ser140. Forigerimod can potently inhibit autophagy....
[Asu1,6]-Oxytocin [Asu1,6]-Oxytocin

[Asu1,6]-Oxytocin

Reference: HY-P3866
€0.00 (tax incl.)
[Asu1,6]-Oxytocin is an analog of oxytocin. [Asu1,6]-Oxytocin reverses insulin resistance and glucose intolerance prior to reduction of obesity. [Asu1,6]-Oxytocin has the potential for the research of obesity and...
HCV-1 e2 Protein (554-569) HCV-1 e2 Protein (554-569)

HCV-1 e2 Protein (554-569)

Reference: HY-P4027
€0.00 (tax incl.)
HCV-1 e2 Protein (554-569) is one of the main antigenic regions of HCV envelope 2 (e2) protein. The HCV-1 e2 Protein (554-569) contains a putative n-glycosylation site, which was previously thought to influence the...
Eledoisin Related Peptide Eledoisin Related Peptide

Eledoisin Related Peptide

Reference: HY-P1186
€0.00 (tax incl.)
Eledoisin Related Peptide is a Substance P analog that excites neurons and triggers behavioral responses. Eledoisin Related Peptide is also a tachykinin receptor ligand.
Selepressin Selepressin

Selepressin

Reference: HY-105239
€0.00 (tax incl.)
Selepressin (FE 202158) is a selective vasopressin V1A receptor agonist. Selepressin is a potent vasopressor. Selepressin can be used in the research of septic shock.
Fmoc-Tyr(tBu)-OH Fmoc-Tyr(tBu)-OH

Fmoc-Tyr(tBu)-OH

Reference: HY-W008016
€0.00 (tax incl.)
Fmoc-Tyr(tBu)-OH is a tyrosine derivative.
Proteasome-activating peptide 1 Proteasome-activating peptide 1

Proteasome-activating peptide 1

Reference: HY-P3414
€0.00 (tax incl.)
Proteasome-activating peptide 1 is a peptide, which increases the chymotrypsin-like proteasomal catalytic activity and, consequently, proteolytic rates both in vitro and in culture. Proteasome-activating peptide 1...
C-Peptide, dog C-Peptide, dog

C-Peptide, dog

Reference: HY-P1475
€0.00 (tax incl.)
C-Peptide, dog is a component of proinsulin, released from pancreatic beta cells into blood together with insulin.
β-Amyloid (10-35), amide β-Amyloid (10-35), amide

β-Amyloid (10-35), amide

Reference: HY-P1567
€0.00 (tax incl.)
β-Amyloid (10-35), amide is composed of 26 aa (10-35 residues of the Aβ peptide) and is the primary component of the amyloid plaques of Alzheimer’s disease.
Boc-Tyr-OtBu Boc-Tyr-OtBu

Boc-Tyr-OtBu

Reference: HY-W019676
€0.00 (tax incl.)
Boc-Tyr-OtBu is a tyrosine derivative.
Calmodulin Dependent Protein Kinase Substrate Calmodulin Dependent Protein Kinase Substrate

Calmodulin Dependent Protein Kinase Substrate

Reference: HY-P3944
€0.00 (tax incl.)
Calmodulin Dependent Protein Kinase Substrate is a Ca2+- and calmodulin (CaM)-dependent protein kinase (CaMK) substrate peptide. Calmodulin Dependent Protein Kinase Substrate is a synthetic peptide substrate for...
Brain Natriuretic Peptide-45, rat TFA Brain Natriuretic Peptide-45, rat TFA

Brain Natriuretic Peptide-45, rat TFA

Reference: HY-P1573A
€0.00 (tax incl.)
Brain Natriuretic Peptide-45, rat TFA (BNP-45, rat TFA) is a circulating form of rat brain natriuretic peptide isolated from rat heart with potent hypotensive and natriuretic potency.
VIHS VIHS

VIHS

Reference: HY-P3705
€0.00 (tax incl.)
VIHS is a 4 amino acid peptide.
COG 133 COG 133

COG 133

Reference: HY-P1050
€0.00 (tax incl.)
COG 133 is a fragment of Apolipoprotein E (APOE) peptide. COG 133 competes with the ApoE holoprotein for binding the LDL receptor, with potent anti-inflammatory and neuroprotective effects. COG 133 is also a nAChR...
H3K27(Me2) (15-34) H3K27(Me2) (15-34)

H3K27(Me2) (15-34)

Reference: HY-P2253
€0.00 (tax incl.)
H3K27(Me2) (15-34), a histone peptide, is a repressive chromatin mark derived from human histone. Polycomb Repressive Complex 2 (PRC2) is a multiprotein complex that catalyzes the methylation of H3K27(Me).
Defensin NP-3A Defensin NP-3A

Defensin NP-3A

Reference: HY-P3981
€0.00 (tax incl.)
Defensin NP-3A (NP-3A; Corticostatin 1) is a human granulocyte peptide, with anti-ACTH activity. Defensins are antimicrobial peptides with and cytotoxic activity.
CEF3 CEF3

CEF3

Reference: HY-P0289
€0.00 (tax incl.)
CEF3 (SIIPSGPLK) corresponds to aa 13-21 of the influenza A virus M1 protein. The matrix (M1) protein of influenza A virus is a multifunctional protein that plays essential structural and functional roles in the virus...
β-Amyloid (1-14),mouse,rat β-Amyloid (1-14),mouse,rat

β-Amyloid (1-14),mouse,rat

Reference: HY-P1524
€0.00 (tax incl.)
β-Amyloid (1-14),mouse,rat is a 1 to 14 fragment of Amyloid-β peptide.
Reversin 121 Reversin 121

Reversin 121

Reference: HY-125486
€0.00 (tax incl.)
Reversin 121 is a P-glycoprotein inhibitor. Reversin 121 increases the ATPase activity of MDR1. Reversin 121 reverses P-glycoprotein-mediated multidrug resistance. Reversin 121 can be used in the research of cancers.
Proteasome-activating peptide 1 TFA Proteasome-activating peptide 1 TFA

Proteasome-activating peptide 1 TFA

Reference: HY-P3414A
€0.00 (tax incl.)
Proteasome-activating peptide 1 TFA is a peptide and a potent proteasome activator. Proteasome-activating peptide 1 TFA increases the chymotrypsin-like proteasomal catalytic activity and, consequently, proteolytic...
Fmoc-Chg-OH Fmoc-Chg-OH

Fmoc-Chg-OH

Reference: HY-22062
€0.00 (tax incl.)
Fmoc-Chg-OH is a Glycine (HY-Y0966) derivative.
Indolicidin TFA Indolicidin TFA

Indolicidin TFA

Reference: HY-P0261B
€0.00 (tax incl.)
Indolicidin TFA is a potent antimicrobial peptide purified from the cytoplasmic granules of bovine neutrophils.
Fmoc-Bpa-OH Fmoc-Bpa-OH

Fmoc-Bpa-OH

Reference: HY-W010793
€0.00 (tax incl.)
Fmoc-Bpa-OH is a phenylalanine derivative.
Fmoc-HoPhe-OH Fmoc-HoPhe-OH

Fmoc-HoPhe-OH

Reference: HY-W009005
€0.00 (tax incl.)
Fmoc-HoPhe-OH is a phenylalanine derivative.
Peptide 401 Peptide 401

Peptide 401

Reference: HY-12537
€0.00 (tax incl.)
Peptide 401, a potent mast cell degranulating factor from bee venom, suppresses the increased vascular permeability due to intradermal injection of various smooth muscle spasmogens (histamine, and 5-HT).
Ac-hMCH(6-16)-NH2 Ac-hMCH(6-16)-NH2

Ac-hMCH(6-16)-NH2

Reference: HY-P3155
€0.00 (tax incl.)
Ac-hMCH(6-16)-NH2 binds to and activates equally well both human MCH receptors present in the brain (non-selective agonist), with IC50 values of 0.16 nM and 2.7 nM for MCH-1R and MCH-2R.
Urotensin II, mouse Urotensin II, mouse

Urotensin II, mouse

Reference: HY-P1483
€0.00 (tax incl.)
Urotensin II, mouse is an endogenous ligand for the orphan G-protein-coupled receptor GPR14 or SENR. Urotensin II, mouse is a potent vasoconstrictor. Urotensin II, mouse plays a physiological role in the central...
Fmoc-D-Leu-OH Fmoc-D-Leu-OH

Fmoc-D-Leu-OH

Reference: HY-W008021
€0.00 (tax incl.)
Fmoc-D-Leu-OH is a leucine derivative.
Defensin HNP-2 human Defensin HNP-2 human

Defensin HNP-2 human

Reference: HY-P2311
€0.00 (tax incl.)
Defensin HNP-2 human is an endogenous antibiotic peptide and monocyte chemotactic peptide produced by human neutrophils.
(D-Phe7)-α-MSH (D-Phe7)-α-MSH

(D-Phe7)-α-MSH

Reference: HY-P3659
€0.00 (tax incl.)
(D-Phe7)-α-MSH is an α-MSH analogue.
TNF-α (31-45), human TNF-α (31-45), human

TNF-α (31-45), human

Reference: HY-P1860
€0.00 (tax incl.)
TNF-α (31-45), human is a peptide of tumor necrosis factor-α.
H-D-Val-OtBu.HCl H-D-Val-OtBu.HCl

H-D-Val-OtBu.HCl

Reference: HY-W014418
€0.00 (tax incl.)
H-D-Val-OtBu.HCl is a valine derivative.
Dansylphenylalanine Dansylphenylalanine

Dansylphenylalanine

Reference: HY-118349
€0.00 (tax incl.)
Dansylphenylalanine is a phenylalanine derivative.
X-press Tag Peptide X-press Tag Peptide

X-press Tag Peptide

Reference: HY-P0329
€0.00 (tax incl.)
X-press Tag Peptide is a tag peptide used for protein purification. X-press Tag is also an N-terminal leader peptide; this N-terminal peptide contains a polyhistidine sequence, the Xpress epitope (part of...
[Leu8,D-Trp22,Tyr25] Somatostatin-28 [Leu8,D-Trp22,Tyr25] Somatostatin-28

[Leu8,D-Trp22,Tyr25] Somatostatin-28

Reference: HY-P3901
€0.00 (tax incl.)
[Leu8,D-Trp22,Tyr25] Somatostatin-28 is the analog of Somatostatin-28. Somatostatin-28 is a intestinal peptide containing somatostatin in its C-terminal portion.
Ac-IEVDIDV TFA Ac-IEVDIDV TFA

Ac-IEVDIDV TFA

Reference: HY-P1965
€0.00 (tax incl.)
Ac-IEVDIDV TFA is a short peptide sequence with Ac at the end.
Omiganan-FITC TFA Omiganan-FITC TFA

Omiganan-FITC TFA

Reference: HY-P2292A
€0.00 (tax incl.)
Omiganan-FITC TFA is a peptide-FITC complex composed of Omiganan and a FITC. Omiganan is a bactericidal and fungicidal cationic peptide being developed as a topical gel for prevention of catheter-associated infections.
Angiotensin II (1-4), human TFA Angiotensin II (1-4), human TFA

Angiotensin II (1-4), human TFA

Reference: HY-P1792A
€0.00 (tax incl.)
Angiotensin II (1-4), human (TFA) is an endogenous peptide produced from AT I by angiotensin-converting-enzyme (ACE). Angiotensin II binds the AT II type 1 (AT1) receptor, stimulating GPCRs in vascular smooth muscle...

Menu

Settings

Please sign in first.

Sign in