Category: Proteins & Peptides

Filter By
Brand: Cayman Chemical Brand: FineTest Brand: Genetex Categories: Peptides Clear all
BODIPY 630/650X succinimide ester BODIPY 630/650X succinimide ester

BODIPY 630/650X succinimide ester

Reference: 27758-1
€0.00 (tax incl.)
An amine-reactive fluorescent probe; has been used, linked to adenosine A1 receptor ligands, as a fluorescent probe to quantify ligand-receptor binding; ex/em = 630/650 nm, respectively
BODIPY 630/650X succinimide ester BODIPY 630/650X succinimide ester

BODIPY 630/650X succinimide ester

Reference: 27758-5
€0.00 (tax incl.)
An amine-reactive fluorescent probe; has been used, linked to adenosine A1 receptor ligands, as a fluorescent probe to quantify ligand-receptor binding; ex/em = 630/650 nm, respectively
Optineurin (C-Term) Blocking Peptide Optineurin (C-Term) Blocking Peptide

Optineurin (C-Term) Blocking Peptide

Reference: 300000-1
€0.00 (tax incl.)
The peptide is identical among human, mous, and rat optineurin, amino acids 559-575 (GEVLPDIDTLQIHVMDC). This blocking peptide can be used in conjunction with Cayman’s Optineurin (C-Term) Polyclonal Antibody (Catalog...
Optineurin (INT) Blocking Peptide Optineurin (INT) Blocking Peptide

Optineurin (INT) Blocking Peptide

Reference: 300002-1
€0.00 (tax incl.)
Peptide Sequence: human optineurin amino acids 115-130 (KGKSERSSEDPTDDSR) · To be used in conjunction with Cayman’s optineurin (INT) polyclonal antibody (Catalog No. 100002) to block protein-antibody complex...
HIF-1α (C-Term) Blocking Peptide HIF-1α (C-Term) Blocking Peptide

HIF-1α (C-Term) Blocking Peptide

Reference: 300003-1
€0.00 (tax incl.)
Peptide Sequence: HIF-1α protein amino acids (SRNLLQGEELLRALDQVN) · To be used in conjunction with Cayman’s HIF-1α Polyclonal Antibody (Item No. 10006421) to block protein-antibody complex formation during...
CD36 Blocking Peptide CD36 Blocking Peptide

CD36 Blocking Peptide

Reference: 300011-1
€0.00 (tax incl.)
Peptide Sequence: human CD36 sequence amino acids 98-114 (AKENVTQDAEDNTVSF) · To be used in conjunction with Cayman’s CD36 polyclonal antibody (Catalog No. 100011) to block protein-antibody complex formation during...
Prostaglandin E Synthase-2 (microsomal) Blocking Peptide Prostaglandin E Synthase-2 (microsomal) Blocking Peptide

Prostaglandin E Synthase-2 (microsomal) Blocking Peptide

Reference: 300012-1
€0.00 (tax incl.)
Peptide Sequence: amino acids 221-235 (VYGGKEARTEEMKWR) · To be used in conjunction with Cayman’s mPGE synthase-2 polyclonal antibody (Catalog No. 160145) to block protein-antibody complex formation during analysis...
β-Catenin Blocking Peptide β-Catenin Blocking Peptide

β-Catenin Blocking Peptide

Reference: 300013-1
€0.00 (tax incl.)
Peptide Sequence: human β-catenin amino acids 43-62 (APSLSGKGNPEEEDVDTSQV) · To be used in conjunction with Cayman’s β-catenin polyclonal antibody (Catalog No. 100029) to block protein-antibody complex formation...
Monoacylglycerol Lipase Blocking Peptide Monoacylglycerol Lipase Blocking Peptide

Monoacylglycerol Lipase Blocking Peptide

Reference: 300014-1
€0.00 (tax incl.)
Peptide Sequence: human monoacylglycerol lipase blocking peptide amino acids 1-14 (MPEESSPRRTPQSI) · To be used in conjunction with Cayman’s Monoacylglycerol Lipase Polyclonal Antibody (Item No. 100035) to block...
CB2 Receptor Blocking Peptide CB2 Receptor Blocking Peptide

CB2 Receptor Blocking Peptide

Reference: 301550-200
€0.00 (tax incl.)
Peptide Sequence: human CB2 receptor sequence amino acids 20-33 (NPMKDYMILSGPQK)(6724) · To be used in conjunction with Cayman’s CB2 receptor polyclonal antibody (Catalog No. 101550) to block protein-antibody complex...
Fatty Acid Amide Hydrolase Blocking Peptide Fatty Acid Amide Hydrolase Blocking Peptide

Fatty Acid Amide Hydrolase Blocking Peptide

Reference: 301600-1
€0.00 (tax incl.)
Peptide Sequence: rat FAAH amino acids sequence 561-579 (CLRFMREVEQLMTPQKQPS)(9140) · To be used in conjunction with Cayman’s FAAH polyclonal antibody (Catalog No. 101600) to block protein-antibody complex formation...
DP1 Receptor Blocking Peptide DP1 Receptor Blocking Peptide

DP1 Receptor Blocking Peptide

Reference: 301640-1
€0.00 (tax incl.)
To be used in conjunction with Cayman’s DP1 Receptor Polyclonal Antibody (Catalog No. 101640) to block protein-antibody complex formation during immunochemical analysis of the DP1 receptor.
PPARγ Blocking Peptide PPARγ Blocking Peptide

PPARγ Blocking Peptide

Reference: 301700-1
€0.00 (tax incl.)
Peptide Sequence: human PPARγ1 amino acids 82-101 (PASPPYYSEKTQLYNKPHEE; amino acids 110-129 of PPARγ2) · To be used in conjunction with Cayman’s PPARγ polyclonal antibody (Catalog No. 101700) to block...
PPARα Blocking Peptide PPARα Blocking Peptide

PPARα Blocking Peptide

Reference: 301710-1
€0.00 (tax incl.)
Peptide sequence: human PPARα amino acids 22-36 (PLSEEFLQEMGNIQE)(6160) · To be used in conjunction with Cayman’s PPARα polyclonal antibody (Item No. 101710) to block protein-antibody complex formation during analysis...
EP1 Receptor Blocking Peptide EP1 Receptor Blocking Peptide

EP1 Receptor Blocking Peptide

Reference: 301740-1
€0.00 (tax incl.)
Peptide Sequence: human EP1 receptor C-terminal amino acids 380-402 (GLTPSAWEASSLRSSRHSGLSHF)(3176) · To be used in conjunction with Cayman’s EP1 receptor polyclonal antibody (Catalog No. 101740) to block...
EP2 Receptor Blocking Peptide EP2 Receptor Blocking Peptide

EP2 Receptor Blocking Peptide

Reference: 301750-200
€0.00 (tax incl.)
Peptide Sequence: human EP2 receptor amino acids 335-358 (SLRTQDATQTSCSTQSDASKQADL)(3178) · To be used in conjunction with Cayman’s EP2 receptor polyclonal antibody (Catalog No. 101750) to block protein-antibody...
EP3 Receptor Blocking Peptide EP3 Receptor Blocking Peptide

EP3 Receptor Blocking Peptide

Reference: 301760-1
€0.00 (tax incl.)
Peptide Sequence: human EP3 receptor sequence amino acids 308-327 (NQTSVEHCKTHTEKQKECNF)(3180,1900) · To be used in conjunction with Cayman’s EP3 receptor polyclonal antibody (Catalog No. 101760) to block...
EP4 Receptor (C-Term) Blocking Peptide EP4 Receptor (C-Term) Blocking Peptide

EP4 Receptor (C-Term) Blocking Peptide

Reference: 301775-200
€0.00 (tax incl.)
Peptide Sequence: human EP4 receptor sequence amino acids 459-488 (GSGRAGPAPKGSSLQVTFPSETLNLSEKCI)(3164,3186) · To be used in conjunction with Cayman’s EP4 receptor polyclonal antibody (Catalog No. 101775) to block...
RICK Blocking Peptide RICK Blocking Peptide

RICK Blocking Peptide

Reference: 301785-200
€0.00 (tax incl.)
Peptide Sequence: human RICK sequence amino acids 11-30 (PTIPYHKLADLRYLSRGASG) · To be used in conjunction with Cayman’s RICK polyclonal antibody (Catalog No. 160785) to block protein-antibody complex formation...
BLT2 Receptor Blocking Peptide BLT2 Receptor Blocking Peptide

BLT2 Receptor Blocking Peptide

Reference: 320124-200
€0.00 (tax incl.)
Peptide sequence: human BLT2 receptor amino acids 325-338 (MELRTTPQLKVVGQ)(8743,8280,8525) · To be used in conjunction with Cayman’s BLT2 receptor polyclonal antibody (Catalog No. 120124) to block protein-antibody...
CysLT1 Receptor Blocking Peptide CysLT1 Receptor Blocking Peptide

CysLT1 Receptor Blocking Peptide

Reference: 320500-200
€0.00 (tax incl.)
Peptide Sequence: human CysLT1 receptor amino acids 318-337 (TYVPRKKASLPEKGEEICKV)(7174) · To be used in conjunction with Cayman’s CysLT1 receptor polyclonal antibody (Catalog No. 120500) to block protein-antibody...
CysLT2 Receptor (C-Term) Blocking Peptide CysLT2 Receptor (C-Term) Blocking Peptide

CysLT2 Receptor (C-Term) Blocking Peptide

Reference: 320550-1
€0.00 (tax incl.)
Peptide Sequence: human CysLT2 receptor amino acids 330-346 · To be used in conjunction with Cayman’s CysLT2 Receptor (C-Term) Polyclonal Antibody (Catalog No. 120550) to block protein-antibody complex formation...
CysLT2 Receptor (N-Term) Blocking Peptide CysLT2 Receptor (N-Term) Blocking Peptide

CysLT2 Receptor (N-Term) Blocking Peptide

Reference: 320560-200
€0.00 (tax incl.)
Peptide Sequence: human CysLT2 receptor N-terminal amino acids 1-18 (MERKFMSLQPSISVSEME)(8519,9059) · To be used in conjunction with Cayman’s CysLT2 receptor (N-term) polyclonal antibody (Catalog No. 120560) to block...
Prostaglandin D Synthase (lipocalin-type) Blocking Peptide Prostaglandin D Synthase (lipocalin-type) Blocking Peptide

Prostaglandin D Synthase (lipocalin-type) Blocking Peptide

Reference: 360003-200
€0.00 (tax incl.)
Peptide Sequence: human lipocalin-type PGD synthase amino acids 30-41 (VQPNFQPDKFLG)(8449) · To be used in conjunction with Cayman’s lipocalin-type PGD synthase polyclonal antibody (Catalog No. 160003) to block...
Prostaglandin D Synthase (hematopoietic-type) Blocking Peptide Prostaglandin D Synthase (hematopoietic-type) Blocking Peptide

Prostaglandin D Synthase (hematopoietic-type) Blocking Peptide

Reference: 360013-200
€0.00 (tax incl.)
Peptide Sequence: Human hematopoietic type PGD synthase amino acids 30-41 (EDHRIEQADWPE)(8451) · To be used in conjunction with Cayman’s hematopoietic type PGD synthase polyclonal antibody (Catalog No. 160013) to...
IP Receptor (mouse) Blocking Peptide IP Receptor (mouse) Blocking Peptide

IP Receptor (mouse) Blocking Peptide

Reference: 360070-1
€0.00 (tax incl.)
Peptide Sequence: human IP receptor amino acids · To be used in conjunction with Cayman’s IP receptor (mouse) polyclonal antibody (Item No. 160070) to block protein-antibody complex formation during immunochemical...
COX-2 (mouse) Blocking Peptide COX-2 (mouse) Blocking Peptide

COX-2 (mouse) Blocking Peptide

Reference: 360106-200
€0.00 (tax incl.)
Peptide Sequence: murine COX-2 amino acids 570-598 (DPQPTKTATINASASHSRLDDINPTVLIK)(1982) · To be used in conjunction with Cayman’s COX-2 (mouse) polyclonal antibodies (Item Nos. 160106, 160116, or 160126) to block...
COX-2 (human) Blocking Peptide COX-2 (human) Blocking Peptide

COX-2 (human) Blocking Peptide

Reference: 360107-200
€0.00 (tax incl.)
Peptide Sequence: human COX-2 amino acids 567-599 (SVPDPELIKTVTINASSSRSGLDDINPTVLLKE)(2) · To be used in conjunction with Cayman’s COX-2 (human) Polyclonal Antibody (Item No. 160107) or the COX-2 (human) monoclonal...
COX-1 (ovine) Blocking Peptide COX-1 (ovine) Blocking Peptide

COX-1 (ovine) Blocking Peptide

Reference: 360108-200
€0.00 (tax incl.)
Peptide Sequence: ovine COX-1 amino acids 272-282 (LMHYPRGIPPQ)(919) · To be used in conjunction with Cayman’s COX-1 (ovine) polyclonal antiserum (Catalog No. 160108) to block protein-antibody complex formation...
COX-1 (mouse) Blocking Peptide COX-1 (mouse) Blocking Peptide

COX-1 (mouse) Blocking Peptide

Reference: 360109-200
€0.00 (tax incl.)
Peptide Sequence: murine COX-1 amino acids 274-288 (LMRYPPGVPPERQMA)(300) · To be used in conjunction with Cayman’s COX-1 (mouse) polyclonal antibody (Item No. 160109) to block protein-antibody complex formation...
Prostaglandin E Synthase-1 (microsomal) Blocking Peptide Prostaglandin E Synthase-1 (microsomal) Blocking Peptide

Prostaglandin E Synthase-1 (microsomal) Blocking Peptide

Reference: 360140-1
€0.00 (tax incl.)
Peptide Sequence: human amino acids 59-75 (CRSDPDVERSLRAHRND)(7229) · To be used in conjunction with Cayman’s microsomal PGE synthase-1 polyclonal antibody (Catalog No. 160140) to block protein-antibody complex...
Prostaglandin E Synthase (cytosolic) Blocking Peptide Prostaglandin E Synthase (cytosolic) Blocking Peptide

Prostaglandin E Synthase (cytosolic) Blocking Peptide

Reference: 360150-1
€0.00 (tax incl.)
Peptide sequence: human cPGE synthase amino acids 58-67 (CIDPNDSKHK)(8691) · To be used in conjunction with Cayman’s cPGEsynthase polyclonal antibody (Catalog No. 160150) to block protein-antibody complex formation...
5-Lipoxygenase Blocking Peptide 5-Lipoxygenase Blocking Peptide

5-Lipoxygenase Blocking Peptide

Reference: 360402-200
€0.00 (tax incl.)
Peptide Sequence: human and rat amino acids 130-149 (QHRRKELETRQKQYRWMEWN)(4212,4211,4210) · To be used in conjunction with Cayman’s 5-LO polyclonal antiserum (Catalog No. 160402) to block protein-antibody complex...
sPLA2 (mouse Type V) Blocking Peptide sPLA2 (mouse Type V) Blocking Peptide

sPLA2 (mouse Type V) Blocking Peptide

Reference: 360512-200
€0.00 (tax incl.)
Peptide sequence: mouse group V sPLA2 amino acids 79-94 (CAIRTQSYDYRYTNGL) · To be used in conjunction with Cayman’s sPLA2 (mouse type V) polyclonal antibody (Item No. 160512) to block protein-antibody complex...
PAF Receptor Blocking Peptide (Monoclonal) PAF Receptor Blocking Peptide (Monoclonal)

PAF Receptor Blocking Peptide (Monoclonal)

Reference: 360600-1
€0.00 (tax incl.)
Peptide Sequence: human amino acids 260-269 (LGFQDSKFHQ).(5109,5148,5150) · To be used in conjunction with Cayman’s PAF receptor monoclonal antibody (Catalog No. 160600) to block protein-antibody complex formation...
PAF Acetylhydrolase Blocking Peptide PAF Acetylhydrolase Blocking Peptide

PAF Acetylhydrolase Blocking Peptide

Reference: 360603-200
€0.00 (tax incl.)
Peptide Sequence: human C-terminal amino acids 420-441 (TNINTTNQHIMLQNSSGIEKYN)(2618) · To be used in conjunction with Cayman’s PAF-AH polyclonal antiserum (Catalog No. 160603) to block protein-antibody complex...
15-hydroxy Prostaglandin Dehydrogenase Blocking Peptide 15-hydroxy Prostaglandin Dehydrogenase Blocking Peptide

15-hydroxy Prostaglandin Dehydrogenase Blocking Peptide

Reference: 360615-200
€0.00 (tax incl.)
Peptide Sequence: amino acids 92-105 (AGVNNEKNWEKTLQ) from the human NAD+-dependent 15-hydroxy PGDH(387) · To be used in conjunction with Cayman’s 15-hydroxy PGDH polyclonal antibody (Catalog No. 160615) to block...
Prostaglandin I Synthase Blocking Peptide Prostaglandin I Synthase Blocking Peptide

Prostaglandin I Synthase Blocking Peptide

Reference: 360640-200
€0.00 (tax incl.)
Peptide Sequence: bovine amino acids 299-329 (LLKNPEALAAVRGELETVLLGAEQPISQMTT)(3477,3476,3478) · To be used in conjunction with Cayman’s PGIS polyclonal antibody (Catalog No. 160640) to block protein-antibody complex...
Thromboxane Synthase Blocking Peptide Thromboxane Synthase Blocking Peptide

Thromboxane Synthase Blocking Peptide

Reference: 360715-200
€0.00 (tax incl.)
Peptide Sequence: human amino acids 359-377 (TNPDCQEKLLREVDVFKEK)(50,4150) · To be used in conjunction with Cayman’s thromboxane synthase polyclonal antibody (Catalog No. 160715) to block protein-antibody complex...
Caspase-3 (human) Blocking Peptide Caspase-3 (human) Blocking Peptide

Caspase-3 (human) Blocking Peptide

Reference: 360745-200
€0.00 (tax incl.)
Peptide Sequence: human caspase-3 sequence amino acids 166-183 (TELDSGIETDSGVDDDMA)(8444) · To be used in conjunction with Cayman’s Caspase-3 (human) Polyclonal Antibody (Catalog No. 160745) to block protein-antibody...
AIF Blocking Peptide AIF Blocking Peptide

AIF Blocking Peptide

Reference: 360773-1
€0.00 (tax incl.)
Peptide Sequence: human AIF amino acids 151-180 (RARDPGARVLIVSEDPELPYMRPPLSKELW) · To be used in conjunction with Cayman’s AIF polyclonal antibody (Catalog No. 160773) to block protein-antibody complex formation...
Apaf-1 Blocking Peptide Apaf-1 Blocking Peptide

Apaf-1 Blocking Peptide

Reference: 360780-200
€0.00 (tax incl.)
Peptide Sequence: human Apaf-1 amino acids 12-28 (HREALEKDIKTSYIMDHC); the sequence of the peptide is identical between human and mouse.(6894,6873) · To be used in conjunction with Cayman’s Apaf-1 polyclonal antibody...
nNOS Blocking Peptide nNOS Blocking Peptide

nNOS Blocking Peptide

Reference: 360871-200
€0.00 (tax incl.)
Peptide Sequence: human nNOS amino acids 1422-1433 (ESKKDTDEVFSS)(1280,4153) · To be used in conjunction with Cayman’s nNOS polyclonal antibody (Catalog No. 160870) to block protein-antibody complex formation during...
eNOS Blocking Peptide eNOS Blocking Peptide

eNOS Blocking Peptide

Reference: 360881-200
€0.00 (tax incl.)
Peptide Sequence: human eNOS amino acids 1186-1203 (RGAVPWAFDPPGSDTNS) · To be used in conjunction with Cayman’s eNOS polyclonal antiserum (Item No. 160880) to block protein-antibody complex formation during analysis...
Guanylate Cyclase α subunit (soluble) Blocking Peptide Guanylate Cyclase α subunit (soluble) Blocking Peptide

Guanylate Cyclase α subunit (soluble) Blocking Peptide

Reference: 360895-200
€0.00 (tax incl.)
Peptide sequences: human guanylate cyclase α subunit amino acids 418-436 (EQARAQDGLKKRLGKLKAT) · To be used in conjunction with Cayman’s guanylate cyclase α subunit polyclonal antibody (Catalog No. 160895) to block...
Guanylate Cyclase β1 subunit (soluble) Blocking Peptide Guanylate Cyclase β1 subunit (soluble) Blocking Peptide

Guanylate Cyclase β1 subunit (soluble) Blocking Peptide

Reference: 360897-200
€0.00 (tax incl.)
Peptide Sequence: soluble rat guanylate cyclase β1 subunit, amino acids 188-207 (EDFYEDLDRFEENGTQDSR; last D=E in human and bovine)(3531,4654,3535) · To be used in conjunction with Cayman’s guanylate cyclase β1...
APRIL peptide APRIL peptide

APRIL peptide

Reference: GTX00459
€0.00 (tax incl.)
The protein encoded by this gene is a member of the tumor necrosis factor (TNF) ligand family. This protein is a ligand for TNFRSF17/BCMA, a member of the TNF receptor family. This protein and its receptor are both...
Syntrophin gamma 1 blocking peptide Syntrophin gamma 1 blocking peptide

Syntrophin gamma 1 blocking peptide

Reference: GTX10079-PEP
€0.00 (tax incl.)
The protein encoded by this gene is a member of the syntrophin family. Syntrophins are cytoplasmic peripheral membrane proteins that typically contain 2 pleckstrin homology (PH) domains, a PDZ domain that bisects the...
VPS35 blocking peptide VPS35 blocking peptide

VPS35 blocking peptide

Reference: GTX10099-PEP
€0.00 (tax incl.)
This gene belongs to a group of vacuolar protein sorting (VPS) genes. The encoded protein is a component of a large multimeric complex, termed the retromer complex, involved in retrograde transport of proteins from...
VPS28 blocking peptide VPS28 blocking peptide

VPS28 blocking peptide

Reference: GTX10133-PEP
€0.00 (tax incl.)
This gene encodes a protein involved in endosomal sorting of cell surface receptors via a multivesicular body/late endosome pathway. The encoded protein is one of the three subunits of the ESCRT-I complex (endosomal...
Dispatched A blocking peptide Dispatched A blocking peptide

Dispatched A blocking peptide

Reference: GTX10142-PEP
€0.00 (tax incl.)
The pattern of cellular proliferation and differentiation that leads to normal development of embryonic structures often depends upon the localized production of secreted protein signals. Cells surrounding the source...
Pallidin blocking peptide Pallidin blocking peptide

Pallidin blocking peptide

Reference: GTX10145-PEP
€0.00 (tax incl.)
The protein encoded by this gene may play a role in intracellular vesicle trafficking. It interacts with Syntaxin 13 which mediates intracellular membrane fusion. Several alternatively spliced transcript variants of...
ORP1 blocking peptide ORP1 blocking peptide

ORP1 blocking peptide

Reference: GTX10151-PEP
€0.00 (tax incl.)
This gene encodes a member of the oxysterol-binding protein (OSBP) family, a group of intracellular lipid receptors. Most members contain an N-terminal pleckstrin homology domain and a highly conserved C-terminal...
ARHGEF18 blocking peptide ARHGEF18 blocking peptide

ARHGEF18 blocking peptide

Reference: GTX10152-PEP
€0.00 (tax incl.)
Rho GTPases are GTP binding proteins that regulate a wide spectrum of cellular functions. These cellular processes include cytoskeletal rearrangements, gene transcription, cell growth and motility. Activation of Rho...
VPS29 (C Terminus) blocking peptide VPS29 (C Terminus) blocking peptide

VPS29 (C Terminus) blocking peptide

Reference: GTX10160-PEP
€0.00 (tax incl.)
This gene belongs to a group of vacuolar protein sorting (VPS) genes that, when functionally impaired, disrupt the efficient delivery of vacuolar hydrolases. The protein encoded by this gene is a component of a large...
SIPA1 blocking peptide SIPA1 blocking peptide

SIPA1 blocking peptide

Reference: GTX10162-PEP
€0.00 (tax incl.)
The product of this gene is a mitogen induced GTPase activating protein (GAP). It exhibits a specific GAP activity for Ras-related regulatory proteins Rap1 and Rap2, but not for Ran or other small GTPases. This...
ACVRL1 blocking peptide ACVRL1 blocking peptide

ACVRL1 blocking peptide

Reference: GTX10179-PEP
€0.00 (tax incl.)
This gene encodes a type I cell-surface receptor for the TGF-beta superfamily of ligands. It shares with other type I receptors a high degree of similarity in serine-threonine kinase subdomains, a glycine- and...
TCP1 alpha blocking peptide TCP1 alpha blocking peptide

TCP1 alpha blocking peptide

Reference: GTX10180-PEP
€0.00 (tax incl.)
The protein encoded by this gene is a molecular chaperone that is a member of the chaperonin containing TCP1 complex (CCT), also known as the TCP1 ring complex (TRiC). This complex consists of two identical stacked...
SSX2IP blocking peptide SSX2IP blocking peptide

SSX2IP blocking peptide

Reference: GTX10256-PEP
€0.00 (tax incl.)
This gene encodes a protein that binds the cancer-testis antigen Synovial Sarcoma X breakpoint 2 protein. The encoded protein may regulate the activity of Synovial Sarcoma X breakpoint 2 protein in malignant cells....
DDX5 blocking peptide DDX5 blocking peptide

DDX5 blocking peptide

Reference: GTX10261-PEP
€0.00 (tax incl.)
DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure, such...
PITPN / PITP alpha blocking peptide PITPN / PITP alpha blocking peptide

PITPN / PITP alpha blocking peptide

Reference: GTX10265-PEP
€0.00 (tax incl.)
This gene encodes a member of a family of lipid-binding proteins that transfer molecules of phosphatidylinositol or phosphatidylcholine between membrane surfaces. The protein is implicated in phospholipase C signaling...
IRF3 blocking peptide IRF3 blocking peptide

IRF3 blocking peptide

Reference: GTX10632-PEP
€0.00 (tax incl.)
This gene encodes a member of the interferon regulatory transcription factor (IRF) family. The encoded protein is found in an inactive cytoplasmic form that upon serine/threonine phosphorylation forms a complex with...
BCAP31 blocking peptide BCAP31 blocking peptide

BCAP31 blocking peptide

Reference: GTX10924-PEP
€0.00 (tax incl.)
This gene encodes a member of the B-cell receptor associated protein 31 superfamily. The encoded protein is a multi-pass transmembrane protein of the endoplasmic reticulum that is involved in the anterograde transport...
IRF6 blocking peptide IRF6 blocking peptide

IRF6 blocking peptide

Reference: GTX10925-PEP
€0.00 (tax incl.)
This gene encodes a member of the interferon regulatory transcription factor (IRF) family. Family members share a highly-conserved N-terminal helix-turn-helix DNA-binding domain and a less conserved C-terminal...
Mad2L2 (3-14) peptide Mad2L2 (3-14) peptide

Mad2L2 (3-14) peptide

Reference: GTX11254
€0.00 (tax incl.)
MAD2L2 is a component of the mitotic spindle assembly checkpoint that prevents the onset of anaphase until all chromosomes are properly aligned at the metaphase plate. MAD2L2 is a homolog of MAD2L1.
gamma Catenin blocking peptide gamma Catenin blocking peptide

gamma Catenin blocking peptide

Reference: GTX11799-PEP
€0.00 (tax incl.)
This gene encodes a major cytoplasmic protein which is the only known constituent common to submembranous plaques of both desmosomes and intermediate junctions. This protein forms distinct complexes with cadherins and...
DCXR blocking peptide DCXR blocking peptide

DCXR blocking peptide

Reference: GTX11800-PEP
€0.00 (tax incl.)
The protein encoded by this gene acts as a homotetramer to catalyze diacetyl reductase and L-xylulose reductase reactions. The encoded protein may play a role in the uronate cycle of glucose metabolism and in the...
ELF1 blocking peptide ELF1 blocking peptide

ELF1 blocking peptide

Reference: GTX11801-PEP
€0.00 (tax incl.)
This gene encodes an E26 transformation-specific related transcription factor. The encoded protein is primarily expressed in lymphoid cells and acts as both an enhancer and a repressor to regulate transcription of...
AKR1A1 blocking peptide AKR1A1 blocking peptide

AKR1A1 blocking peptide

Reference: GTX11802-PEP
€0.00 (tax incl.)
This gene encodes a member of the aldo/keto reductase superfamily, which consists of more than 4 known enzymes and proteins. This member, also known as aldehyde reductase, is involved in the reduction of biogenic and...
SF3B4 blocking peptide SF3B4 blocking peptide

SF3B4 blocking peptide

Reference: GTX11803-PEP
€0.00 (tax incl.)
This gene encodes one of four subunits of the splicing factor 3B. The protein encoded by this gene cross-links to a region in the pre-mRNA immediately upstream of the branchpoint sequence in pre-mRNA in the...
FSTL1 blocking peptide FSTL1 blocking peptide

FSTL1 blocking peptide

Reference: GTX11805-PEP
€0.00 (tax incl.)
This gene encodes a protein with similarity to follistatin, an activin-binding protein. It contains an FS module, a follistatin-like sequence containing 1 conserved cysteine residues. This gene product is thought to...
DCTN1 blocking peptide DCTN1 blocking peptide

DCTN1 blocking peptide

Reference: GTX11806-PEP
€0.00 (tax incl.)
This gene encodes the largest subunit of dynactin, a macromolecular complex consisting of 1 subunits ranging in size from 22 to 15 kD. Dynactin binds to both microtubules and cytoplasmic dynein. Dynactin is involved...
Flotillin 1 blocking peptide Flotillin 1 blocking peptide

Flotillin 1 blocking peptide

Reference: GTX13493-PEP
€0.00 (tax incl.)
Caveolae are small domains on the inner cell membrane involved in vesicular trafficking and signal transduction. FLOT1 encodes a caveolae-associated, integral membrane protein. The function of flotillin 1 has not been...
MATH1 (188-200) peptide (BSA) MATH1 (188-200) peptide (BSA)

MATH1 (188-200) peptide (BSA)

Reference: GTX13519
€0.00 (tax incl.)
This protein belongs to the basic helix-loop-helix (BHLH) family of transcription factors. It activates E-box dependent transcription along with E47.
ADAM17 blocking peptide ADAM17 blocking peptide

ADAM17 blocking peptide

Reference: GTX13535-PEP
€0.00 (tax incl.)
This gene encodes a member of the ADAM (a disintegrin and metalloprotease domain) family. Members of this family are membrane-anchored proteins structurally related to snake venom disintegrins, and have been...
AIRE (isoforms 1 and 2) blocking peptide AIRE (isoforms 1 and 2) blocking peptide

AIRE (isoforms 1 and 2) blocking peptide

Reference: GTX13573-PEP
€0.00 (tax incl.)
This gene encodes a transcriptional regulator that forms nuclear bodies and interacts with the transcriptional coactivator CREB binding protein. The encoded protein plays an important role in immunity by regulating...
TrxR1 blocking peptide TrxR1 blocking peptide

TrxR1 blocking peptide

Reference: GTX13574-PEP
€0.00 (tax incl.)
This gene encodes a member of the family of pyridine nucleotide oxidoreductases. This protein reduces thioredoxins as well as other substrates, and plays a role in selenium metabolism and protection against oxidative...
ELF5 blocking peptide ELF5 blocking peptide

ELF5 blocking peptide

Reference: GTX13581-PEP
€0.00 (tax incl.)
The protein encoded by this gene is a member of an epithelium-specific subclass of the Ets transcritpion factor family. In addition to its role in regulating the later stages of terminal differentiation of...
PAX8 (N Terminus) blocking peptide PAX8 (N Terminus) blocking peptide

PAX8 (N Terminus) blocking peptide

Reference: GTX13611-PEP
€0.00 (tax incl.)
This gene encodes a member of the paired box (PAX) family of transcription factors. Members of this gene family typically encode proteins that contain a paired box domain, an octapeptide, and a paired-type...
MAD2L1 blocking peptide MAD2L1 blocking peptide

MAD2L1 blocking peptide

Reference: GTX13615-PEP
€0.00 (tax incl.)
MAD2L1 is a component of the mitotic spindle assembly checkpoint that prevents the onset of anaphase until all chromosomes are properly aligned at the metaphase plate. MAD2L1 is related to the MAD2L2 gene located on...
JWA blocking peptide JWA blocking peptide

JWA blocking peptide

Reference: GTX13618-PEP
€0.00 (tax incl.)
Expression of this gene is affected by vitamin A. The encoded protein of this gene may be associated with the cytoskeleton. A similar protein in rats may play a role in the regulation of cell differentiation. The rat...
ACADM blocking peptide ACADM blocking peptide

ACADM blocking peptide

Reference: GTX13677-PEP
€0.00 (tax incl.)
This gene encodes the medium-chain specific (C4 to C12 straight chain) acyl-Coenzyme A dehydrogenase. The homotetramer enzyme catalyzes the initial step of the mitochondrial fatty acid beta-oxidation pathway. Defects...
SETDB2 blocking peptide SETDB2 blocking peptide

SETDB2 blocking peptide

Reference: GTX13712-PEP
€0.00 (tax incl.)
Proteins that contain a SET domain, such as SETDB2, modulate gene expression epigenetically through histone H3 (see MIM 61128) methylation. SETDB2 is likely a histone H3 methyltransferase, as it contains both the...
ACTR1A blocking peptide ACTR1A blocking peptide

ACTR1A blocking peptide

Reference: GTX13796-PEP
€0.00 (tax incl.)
This gene encodes a 42.6 kD subunit of dynactin, a macromolecular complex consisting of 1-11 subunits ranging in size from 22 to 15 kD. Dynactin binds to both microtubules and cytoplasmic dynein. It is involved in a...
TXNDC5 blocking peptide TXNDC5 blocking peptide

TXNDC5 blocking peptide

Reference: GTX13820-PEP
€0.00 (tax incl.)
This gene encodes a protein-disulfide isomerase. Its expression is induced by hypoxia and its role may be to protect hypoxic cells from apoptosis. Alternative splicing results in multiple transcript variants....
CDT1 blocking peptide CDT1 blocking peptide

CDT1 blocking peptide

Reference: GTX14676-PEP
€0.00 (tax incl.)
The protein encoded by this gene is involved in the formation of the pre-replication complex that is necessary for DNA replication. The encoded protein can bind geminin, which prevents replication and may function to...
p70 S6K blocking peptide p70 S6K blocking peptide

p70 S6K blocking peptide

Reference: GTX14708-PEP
€0.00 (tax incl.)
This gene encodes a member of the ribosomal S6 kinase family of serine/threonine kinases. The encoded protein responds to mTOR (mammalian target of rapamycin) signaling to promote protein synthesis, cell growth, and...
BS69 blocking peptide BS69 blocking peptide

BS69 blocking peptide

Reference: GTX14747-PEP
€0.00 (tax incl.)
The protein encoded by this gene was first identified by its ability to bind the adenovirus E1A protein. The protein localizes to the nucleus. It functions as a transcriptional repressor, and expression of E1A...
MID2 blocking peptide MID2 blocking peptide

MID2 blocking peptide

Reference: GTX14749-PEP
€0.00 (tax incl.)
The protein encoded by this gene is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. The protein...
RNF2 blocking peptide RNF2 blocking peptide

RNF2 blocking peptide

Reference: GTX14751-PEP
€0.00 (tax incl.)
Polycomb group (PcG) of proteins form the multiprotein complexes that are important for the transcription repression of various genes involved in development and cell proliferation. The protein encoded by this gene is...
ETEA blocking peptide ETEA blocking peptide

ETEA blocking peptide

Reference: GTX14759-PEP
€0.00 (tax incl.)
The protein encoded by this gene is highly expressed in peripheral blood of patients with atopic dermatitis (AD), compared to normal individuals. It may play a role in regulating the resistance to apoptosis that is...
Coronin 1A blocking peptide Coronin 1A blocking peptide

Coronin 1A blocking peptide

Reference: GTX14787-PEP
€0.00 (tax incl.)
This gene encodes a member of the WD repeat protein family. WD repeats are minimally conserved regions of approximately 4 amino acids typically bracketed by gly-his and trp-asp (GH-WD), which may facilitate formation...
ACE2 peptide (192-208) ACE2 peptide (192-208)

ACE2 peptide (192-208)

Reference: GTX15351
€0.00 (tax incl.)
Angiotensin-converting enzyme 2 (ACE2) plays a central role in vascular, renal, and myocardial physiology. In contrast to its homolog ACE, ACE2 expression is restricted to heart, kidney, and testis. Recently ACE2 has...

Menu

Settings

Please sign in first.

Sign in