Proteins & Peptides (2)

Big Endothelin-2 (1-38), human

Reference: HY-P3734

€0.00 (tax incl.)

Big Endothelin-2 (1-38), human is a polypeptide.

BIO-11006 acetate

Reference: HY-106377A

€0.00 (tax incl.)

BIO-11006 acetate, an analog of the MANS peptide, is a MARCKS (myristoylated alanine-rich C kinase substrate) inhibitor.

β-Amyloid 22-35 (Amyloid β-Protein 22-35), the residues 22-35 fragment ofβ-amyloid protein, has a cytotoxic effect on cultured neurons from the rat hippocampus in serum-free medium. β-Amyloid 22-35 forms aggregates...

Dimethyl 3,3'-disulfanediyl(2R,2'R)-bis(2-aminopropanoate) dihydrochloride

Reference: HY-W009117

€0.00 (tax incl.)

Dimethyl 3,3'-disulfanediyl(2R,2'R)-bis(2-aminopropanoate) dihydrochloride is a cysteine derivative.

NoxA1ds TFA

Reference: HY-P1435A

€0.00 (tax incl.)

NoxA1ds TFA is a potent and selective NADPH oxidase 1 (NOX1) inhibitor (IC50=20 nM). NoxA1ds TFA exhibits selectivity for NOX1 over NOX2, NOX4, NOX5 and xanthine oxidase. NoxA1ds TFA inhibits NOX1-derived O2-...

sGnRH-A acetate

Reference: HY-P3582A

€0.00 (tax incl.)

sGnRH-A acetate is a salmon gonadotropin-releasing hormone (GnRH) analogue. sGnRH-A acetate stimulates growth hormone secretion. sGnRH-A acetate also can be used as an inducer of ovulation by artificial insemination.

Ezatiostat

Reference: HY-13634A

€0.00 (tax incl.)

Ezatiostat (TER199 free base; TLK199) is a tripeptide analog of glutathione and is a selective and orally active glutathione S-transferase P1-1 (GSTP1) inhibitor. Ezatiostat leads to JNK activation by inhibiting...

PL-017 TFA

Reference: HY-P1338A

€0.00 (tax incl.)

PL-017 TFA is a potent and selective μ opioid receptor agonist with an IC50 of 5.5 nM for 125I-FK 33,824 binding to μ site. PL-017 TFA produces long-lasting, reversible analgesia in rats.

((4'-Chloro-[1,1'-biphenyl]-4-yl)sulfonyl)phenylalanine

Reference: HY-W030573

€0.00 (tax incl.)

((4'-Chloro-[1,1'-biphenyl]-4-yl)sulfonyl)phenylalanine is a phenylalanine derivative.

Z-Val-Ala-OH

Reference: HY-42709

€0.00 (tax incl.)

Z-Val-Ala-OH is a dipeptide derivative of valine and alanine.

WL12

Reference: HY-P3440

€0.00 (tax incl.)

WL12 is a specifically targeting programmed death ligand 1 (PD-L1) binding peptide. WL12 can be radiolabeled by different radionuclides, generating radiotracers, which can assess the tumor PD-L1 expression.

N-(4-Nitrobenzoyl)glycine

Reference: HY-W028991

€0.00 (tax incl.)

N-(4-Nitrobenzoyl)glycine is a Glycine (HY-Y0966) derivative.

Biotin-NeurokininA

Reference: HY-P3861

€0.00 (tax incl.)

Biotin-NeurokininA is a biotinylated NeurokininA (HY-P0197). Neurokinin A (Substance K), a peptide neurotransmitter of the tachykinin family, acts via the NK-2 receptor. Neurokinin A acts as a major mediator in human...

N-((Benzyloxy)carbonyl)-N-methyl-L-valine

Reference: HY-W011722

€0.00 (tax incl.)

N-((Benzyloxy)carbonyl)-N-methyl-L-valine is a valine derivative.

Acetyl Gastric Inhibitory Peptide (human)

Reference: HY-P3580

€0.00 (tax incl.)

Acetyl Gastric Inhibitory Peptide (human) is a fatty acid derivatized analog of glucose-dependent insulinotropic polypeptide with improved antihyperglycaemic and insulinotropic properties. Acetyl Gastric Inhibitory...

VKGILS-NH2

Reference: HY-P1310

€0.00 (tax incl.)

VKGILS-NH2 is a reversed amino acid sequence control peptide for SLIGKV-NH2 (protease-activated receptor 2 (PAR2) agonist). VKGILS-NH2 has no effect on DNA synthesis in cells.

Prolactin Releasing Peptide (12-31), human

Reference: HY-P1530

€0.00 (tax incl.)

Prolactin Releasing Peptide (12-31), human is a fragment of the prolactin releasing peptide (PrRP). Prolactin Releasing Peptide (1-31), human is a high affinity GPR10 ligand that cause the release of the prolactin.

PKG inhibitor peptide TFA

Reference: HY-P1292A

€0.00 (tax incl.)

PKG inhibitor peptide TFA is an ATP-competitive inhibitor of cGMP-dependent protein kinase (PKG), with a Ki of 86 μM.

RERHNGWRKSVLMVSYGFYVP

Reference: HY-P3464

€0.00 (tax incl.)

RERHNGWRKSVLMVSYGFYVP is a synthetic peptide.

α-Conotoxin PIA TFA

Reference: HY-P1268A

€0.00 (tax incl.)

α-Conotoxin PIA TFA is a nicotinic acetylcholine receptor (nAChR) antagonist that targets nAChR subtypes containing α6 and α3 subunits. α-Conotoxin PIA has the potential for the research of Parkinson’s disease, and...

H-His(1-Me)-OMe

Reference: HY-W016330

€0.00 (tax incl.)

H-His(1-Me)-OMe is a histidine derivative that can be used for amino acid synthesis.

Ethyl 2-(2-(2-(4-chlorophenoxy)phenyl)-N-methylacetamido)acetate

Reference: HY-20153

€0.00 (tax incl.)

Ethyl 2-(2-(2-(4-chlorophenoxy)phenyl)-N-methylacetamido)acetate is a Glycine (HY-Y0966) derivative.

OVA Peptide(257-264) TFA

Reference: HY-P1489A

€0.00 (tax incl.)

OVA Peptide(257-264) TFA is a class I (Kb)-restricted peptide epitope of OVA, an octameric peptide can be from ovalbumin presented by the class I MHC molecule, H-2Kb.

Endothelin 1 (swine, human), Alexa Fluor 488-labeled

Reference: HY-P2496

€0.00 (tax incl.)

Endothelin 1 (swine, human), Alexa Fluor 488-labeled is a synthetic Endothelin 1 peptide labled with Alexa Fluor 488. Endothelin 1 (swine, human) is a synthetic peptide with the sequence of human and swine Endothelin...

Neuromedin S(rat)

Reference: HY-P1239

€0.00 (tax incl.)

Neuromedin S(rat) is a 34-amino acids peptide from rat Neuromedin S. Neuromedin S is a neuropeptide isolated from rat brain. Neuromedin S acts as a ligand for the G protein-coupled receptor FM4/TGR-1

4-Fluoro-DL-glutamic acid

Reference: HY-W141942

€0.00 (tax incl.)

4-Fluoro-DL-glutamic acid is a glutamic acid derivative.

Ala-Gly-Ala

Reference: HY-P4242

€0.00 (tax incl.)

Ala-Gly-Ala is a prototype of a general tripeptide Xxx-Gly-Zzz. Except glycine and proline, there can be 18 possible amino acids for Xxx and another 18 amino acids for Zzz. Ala-Gly-Ala can be used as a model for up to...

Jagged-1 (188-204)

Reference: HY-P1846

€0.00 (tax incl.)

Jagged-1 (188-204) is a fragment of the Jagged-1 (JAG-1) protein with Notch agonist activity. JAG-1 is a Notch ligand highly expressed in cultured and primary multiple myeloma (MM) cells. JAG-1 induces maturation of...

(S)-2-((((9H-Fluoren-9-yl)methoxy)carbonyl)amino)-5-(tert-butoxy)-5-oxopentanoic acid hydrate

Reference: HY-W008667

€0.00 (tax incl.)

(S)-2-((((9H-Fluoren-9-yl)methoxy)carbonyl)amino)-5-(tert-butoxy)-5-oxopentanoic acid hydrate is a glutamic acid derivative.

H-ILE-ARG-VAL-VAL-MET-OH

Reference: HY-P3972

€0.00 (tax incl.)

H-ILE-ARG-VAL-VAL-MET-OH is a pentapeptide from C7 with a domain that supports cell attachment. H-ILE-ARG-VAL-VAL-MET-OH is also the sequence fragment that binds to the thrombospondin-1 (TS1) receptor.

GHGVYGHGVYGHGPYGHGPYGHGLYW

Reference: HY-P3401

€0.00 (tax incl.)

GHGVYGHGVYGHGPYGHGPYGHGLYW (DgHBP-2) is 26-amino-acid-long consensus peptide derived from histidine-rich beak protein-2 (DgHBP-2). GHGVYGHGVYGHGPYGHGPYGHGLYW can be used fabricated glucose-responsive insulin delivery...

Z-D-Phg-OH

Reference: HY-75332

€0.00 (tax incl.)

Z-D-Phg-OH (D-Cbz phenylglycine) is a N-blocked amino acids with Kd values of 390 μM and 323 μM for tBuCQN and tBuCQD, respectively.

GIP (3-42), human

Reference: HY-P2542

€0.00 (tax incl.)

GIP (3-42), human acts as a glucose-dependent insulinotropic polypeptide (GIP) receptor antagonist, moderating the insulin secreting and metabolic actions of GIP in vivo.

Substance P(1-4)

Reference: HY-P3598

€0.00 (tax incl.)

Substance P(1-4) is a potent neurokinin receptors (NK-R) antagonist. Substance P(1-4) has regulation of normal hematopoiesis and inhibits endogenous erythroid colony (EEC) formation.

NMNNAGDKWSAFLKEQSTLAQMYPLQEIQNLTVKLQLQALQQ

Reference: HY-P3142

€0.00 (tax incl.)

NMNNAGDKWSAFLKEQSTLAQMYPLQEIQNLTVKLQLQALQQ is an angiotensin-converting enzyme 2 (ACE2) related peptide that can be used as a tool for understanding ACE2 functions.

Fequesetide

Reference: HY-P2463

€0.00 (tax incl.)

Fequesetide, a peptide segment, is the active site within the protein thymosin β4 responsible for actin binding, cell migration and wound healing.

Adipokinetic hormone (Gryllus bimaculatus)

Reference: HY-P3568

€0.00 (tax incl.)

Adipokinetic hormone Gryllus bimaculatus (Grybi-AKH) is an adipokinetic hormone that regulates energy homeostasis in insects by mobilizing lipid and carbohydrate from the fat body. Adipokinetic hormone Gryllus...

(S)-4-(tert-Butoxy)-3-((tert-butoxycarbonyl)amino)-4-oxobutanoic acid

Reference: HY-W007573

€0.00 (tax incl.)

(S)-4-(tert-Butoxy)-3-((tert-butoxycarbonyl)amino)-4-oxobutanoic acid is an aspartic acid derivative.

Boc-Gly-Gly-OH

Reference: HY-W013968

€0.00 (tax incl.)

Boc-Gly-Gly-OH is a Glycine (HY-Y0966) derivative.

Exendin (5-39)

Reference: HY-P2497

€0.00 (tax incl.)

Exendin (5-39) is a potent glucagon-like peptide 1 (GLP-1) receptor antagonist. Exendin (5-39) improves memory impairment in β-amyloid protein-treated rats.

(Nle4)-α-MSH

Reference: HY-P3645

€0.00 (tax incl.)

(Nle4)-α-MSH is a synthetic analogue of α-MSH (HY-P0252), a melanocyte-stimulating hormone. (Nle4)-α-MSH reversibly darkens frog skins and also exhibits prolonged activity after heat-alkali treatment.

Arg-Gly-Asp-Ser

Reference: HY-12290

€0.00 (tax incl.)

Arg-Gly-Asp-Ser is an integrin binding sequence that inhibits integrin receptor function. Arg-Gly-Asp-Ser directly and specifically bind pro-caspase-8, pro-caspase-9 and pro-caspase-3, while it does not bind...

Cyclo(Arg-Gly-Asp-D-Phe-Val)

Reference: HY-P1613

€0.00 (tax incl.)

Cyclo(Arg-Gly-Asp-D-Phe-Val) is an integrin αvβ3 inhibitor. Cyclo(Arg-Gly-Asp-D-Phe-Val) has antitumor activity. Cyclo(Arg-Gly-Asp-D-Phe-Val) can be used for the research of acute myeloid leukemia.

Mibenratide

Reference: HY-P3557

€0.00 (tax incl.)

Mibenratide, a small cyclic peptide, is an adrenergic β1 receptor antagonist. Mibenratide can be used for heart failure research.

Neuropeptide EI, rat

Reference: HY-P1869

€0.00 (tax incl.)

Neuropeptide EI, rat displays functional melanin concentrating hormone (MCH)-antagonist and melanocyte-stimulating hormone (MSH) agonist activity in different behavioral paradigms.

Ac-D-Ala-OH

Reference: HY-W012713

€0.00 (tax incl.)

Ac-D-Ala-OH is an alanine derivative.

CAP 37 (20-44)

Reference: HY-P3911

€0.00 (tax incl.)

CAP 37 (20-44) is a peptide based on amino acid residues 20 through 44 of CAP37. CAP37, a Cationic antimicrobial protein of 37 kDa, is a multifunctional protein.

FSLLRY-NH2

Reference: HY-P1260

€0.00 (tax incl.)

FSLLRY-NH2 is a protease-activated receptor 2 (PAR2) inhibitor.

Teduglutide

Reference: HY-P1624

€0.00 (tax incl.)

Teduglutide is a dipeptidyl peptidase IV resistant glucagon-like peptide 2 (GLP-2) analogue. Teduglutide is associated with trophic effects on gut mucosa. Teduglutide can be used for the research of short bowel...

(Gly22)-Amyloid β-Protein (1-42)

Reference: HY-P3845

€0.00 (tax incl.)

(Gly22)-Amyloid β-Protein (1-42) is a peptide fragment of amyloid β-protein (Aβ). Amyloid β-protein is the primary component of both vascular and parenchymal amyloid deposits in Alzheimer's disease. Mutation of Glu22...

H-Gly-OBzl.TosOH

Reference: HY-W011200

€0.00 (tax incl.)

H-Gly-OBzl.TosOH is a Glycine (HY-Y0966) derivative.

trans-N-Methyl-4-methoxyproline

Reference: HY-W065053

€0.00 (tax incl.)

trans-N-Methyl-4-methoxyproline is a natural product that can be isolated from the stems of Petiveria alliacea and is also a Proline derivative.

FFAGLDD

Reference: HY-P2004

€0.00 (tax incl.)

FFAGLDD is MMP9 selective cleavage peptides, which used for cytosolic delivery of Doxorubi-cin (DOX) and achieve temporally and spatially controlled slow drug delivery and release.

Fmoc-Asp(OcHex)-OH

Reference: HY-W013659

€0.00 (tax incl.)

Fmoc-Asp(OcHex)-OH is an aspartic acid derivative.

α-Helical CRF(9-41) TFA

Reference: HY-P1294A

€0.00 (tax incl.)

α-Helical CRF(9-41) TFA is a competitive CRF2 receptor antagonist with KB of ~100 nM. α-Helical CRF(9-41) TFA is also a partial agonist of CRF1 receptor with an EC50 of 140 nM.

Z-Ser-OH

Reference: HY-W007842

€0.00 (tax incl.)

Z-Ser-OH is a serine derivative.

KGDS

Reference: HY-P3523

€0.00 (tax incl.)

KGDS is synthetic peptides, targeting integrin GPIIb-IIIa located on the membrane of human activated platelets. Amino acid sequence: Lys-Gly-Asp-Ser.

(S)-2-((S)-2-Amino-3-(1H-imidazol-4-yl)propanamido)-4-methylpentanoic acid

Reference: HY-W009392

€0.00 (tax incl.)

(S)-2-((S)-2-Amino-3-(1H-imidazol-4-yl)propanamido)-4-methylpentanoic acid is a leucine derivative.

Fmoc-Cpa-OH

Reference: HY-W041983

€0.00 (tax incl.)

Fmoc-Cpa-OH is a compound containing both an amino group and a carboxyl group.

Forigerimod

Reference: HY-105037

€0.00 (tax incl.)

Forigerimod (IPP-201101) is a CD4 T-cell modulator. Forigerimod is a 21-amino-acid fragment of U1 small nuclear ribonucleoprotein 70 kDa that is phosphorylated at Ser140. Forigerimod can potently inhibit autophagy....

[Asu1,6]-Oxytocin

Reference: HY-P3866

€0.00 (tax incl.)

[Asu1,6]-Oxytocin is an analog of oxytocin. [Asu1,6]-Oxytocin reverses insulin resistance and glucose intolerance prior to reduction of obesity. [Asu1,6]-Oxytocin has the potential for the research of obesity and...

N-(2,4-Dinitrophenyl)-L-serine

Reference: HY-W142081

€0.00 (tax incl.)

N-(2,4-Dinitrophenyl)-L-serine is a serine derivative.

N-Fmoc-L-valine N-succinimidyl ester

Reference: HY-78733

€0.00 (tax incl.)

N-Fmoc-L-valine N-succinimidyl ester is a valine derivative.

HCV-1 e2 Protein (554-569)

Reference: HY-P4027

€0.00 (tax incl.)

HCV-1 e2 Protein (554-569) is one of the main antigenic regions of HCV envelope 2 (e2) protein. The HCV-1 e2 Protein (554-569) contains a putative n-glycosylation site, which was previously thought to influence the...

Eledoisin Related Peptide

Reference: HY-P1186

€0.00 (tax incl.)

Eledoisin Related Peptide is a Substance P analog that excites neurons and triggers behavioral responses. Eledoisin Related Peptide is also a tachykinin receptor ligand.

L-Phenylalanyl-L-leucine

Reference: HY-W068839

€0.00 (tax incl.)

L-Phenylalanyl-L-leucine is a leucine derivative.

Selepressin

Reference: HY-105239

€0.00 (tax incl.)

Selepressin (FE 202158) is a selective vasopressin V1A receptor agonist. Selepressin is a potent vasopressor. Selepressin can be used in the research of septic shock.

Fmoc-Tyr(tBu)-OH

Reference: HY-W008016

€0.00 (tax incl.)

Fmoc-Tyr(tBu)-OH is a tyrosine derivative.

Proteasome-activating peptide 1

Reference: HY-P3414

€0.00 (tax incl.)

Proteasome-activating peptide 1 is a peptide, which increases the chymotrypsin-like proteasomal catalytic activity and, consequently, proteolytic rates both in vitro and in culture. Proteasome-activating peptide 1...

(R)-Pyrrolidine-3-carboxylic acid

Reference: HY-60256

€0.00 (tax incl.)

(R)-Pyrrolidine-3-carboxylic acid is a proline derivative.

C-Peptide, dog

Reference: HY-P1475

€0.00 (tax incl.)

C-Peptide, dog is a component of proinsulin, released from pancreatic beta cells into blood together with insulin.

β-Amyloid (10-35), amide

Reference: HY-P1567

€0.00 (tax incl.)

β-Amyloid (10-35), amide is composed of 26 aa (10-35 residues of the Aβ peptide) and is the primary component of the amyloid plaques of Alzheimer’s disease.

Boc-Tyr-OtBu

Reference: HY-W019676

€0.00 (tax incl.)

Boc-Tyr-OtBu is a tyrosine derivative.

Calmodulin Dependent Protein Kinase Substrate

Reference: HY-P3944

€0.00 (tax incl.)

Calmodulin Dependent Protein Kinase Substrate is a Ca2+- and calmodulin (CaM)-dependent protein kinase (CaMK) substrate peptide. Calmodulin Dependent Protein Kinase Substrate is a synthetic peptide substrate for...

Brain Natriuretic Peptide-45, rat TFA

Reference: HY-P1573A

€0.00 (tax incl.)

Brain Natriuretic Peptide-45, rat TFA (BNP-45, rat TFA) is a circulating form of rat brain natriuretic peptide isolated from rat heart with potent hypotensive and natriuretic potency.

VIHS

Reference: HY-P3705

€0.00 (tax incl.)

VIHS is a 4 amino acid peptide.

TNF-α (46-65), human

Reference: HY-P1875

€0.00 (tax incl.)

TNF-α (46-65), human is a peptide of TNF-α.

COG 133

Reference: HY-P1050

€0.00 (tax incl.)

COG 133 is a fragment of Apolipoprotein E (APOE) peptide. COG 133 competes with the ApoE holoprotein for binding the LDL receptor, with potent anti-inflammatory and neuroprotective effects. COG 133 is also a nAChR...

H3K27(Me2) (15-34)

Reference: HY-P2253

€0.00 (tax incl.)

H3K27(Me2) (15-34), a histone peptide, is a repressive chromatin mark derived from human histone. Polycomb Repressive Complex 2 (PRC2) is a multiprotein complex that catalyzes the methylation of H3K27(Me).

Carcinoembryonic Antigen (CEA)

Reference: HY-P0277

€0.00 (tax incl.)

Carcinoembryonic Antigen (CEA) is a tumor marker in lung cancer.

Glucagon-like peptide 1 (1-37), human

Reference: HY-P1145

€0.00 (tax incl.)

Glucagon-like peptide 1 (1-37), human is a highly potent agonist of the GLP-1 receptor.

Defensin NP-3A

Reference: HY-P3981

€0.00 (tax incl.)

Defensin NP-3A (NP-3A; Corticostatin 1) is a human granulocyte peptide, with anti-ACTH activity. Defensins are antimicrobial peptides with and cytotoxic activity.

IFN-α Receptor Recognition Peptide 1

Reference: HY-P1758

€0.00 (tax incl.)

IFN-α Receptor Recognition Peptide 1 is a peptide of IFN-α associated with receptor interactions.

(R)-2-((((9H-Fluoren-9-yl)methoxy)carbonyl)amino)-3-cyclohexylpropanoic acid

Reference: HY-W011001

€0.00 (tax incl.)

(R)-2-((((9H-Fluoren-9-yl)methoxy)carbonyl)amino)-3-cyclohexylpropanoic acid is an alanine derivative.

CEF3

Reference: HY-P0289

€0.00 (tax incl.)

CEF3 (SIIPSGPLK) corresponds to aa 13-21 of the influenza A virus M1 protein. The matrix (M1) protein of influenza A virus is a multifunctional protein that plays essential structural and functional roles in the virus...

β-Amyloid (1-14),mouse,rat

Reference: HY-P1524

€0.00 (tax incl.)

β-Amyloid (1-14),mouse,rat is a 1 to 14 fragment of Amyloid-β peptide.

Reversin 121

Reference: HY-125486

€0.00 (tax incl.)

Reversin 121 is a P-glycoprotein inhibitor. Reversin 121 increases the ATPase activity of MDR1. Reversin 121 reverses P-glycoprotein-mediated multidrug resistance. Reversin 121 can be used in the research of cancers.

Proteasome-activating peptide 1 TFA

Reference: HY-P3414A

€0.00 (tax incl.)

Proteasome-activating peptide 1 TFA is a peptide and a potent proteasome activator. Proteasome-activating peptide 1 TFA increases the chymotrypsin-like proteasomal catalytic activity and, consequently, proteolytic...

Fmoc-Chg-OH

Reference: HY-22062

€0.00 (tax incl.)

Fmoc-Chg-OH is a Glycine (HY-Y0966) derivative.

Indolicidin TFA

Reference: HY-P0261B

€0.00 (tax incl.)

Indolicidin TFA is a potent antimicrobial peptide purified from the cytoplasmic granules of bovine neutrophils.

3-Bromo-DL-phenylalanine

Reference: HY-W003225

€0.00 (tax incl.)

3-Bromo-DL-phenylalanine is a phenylalanine derivative.

Fmoc-Bpa-OH

Reference: HY-W010793

€0.00 (tax incl.)

Fmoc-Bpa-OH is a phenylalanine derivative.

Fmoc-HoPhe-OH

Reference: HY-W009005

€0.00 (tax incl.)

Fmoc-HoPhe-OH is a phenylalanine derivative.

Peptide 401

Reference: HY-12537

€0.00 (tax incl.)

Peptide 401, a potent mast cell degranulating factor from bee venom, suppresses the increased vascular permeability due to intradermal injection of various smooth muscle spasmogens (histamine, and 5-HT).

Ac-hMCH(6-16)-NH2

Reference: HY-P3155

€0.00 (tax incl.)

Ac-hMCH(6-16)-NH2 binds to and activates equally well both human MCH receptors present in the brain (non-selective agonist), with IC50 values of 0.16 nM and 2.7 nM for MCH-1R and MCH-2R.

Urotensin II, mouse

Reference: HY-P1483

€0.00 (tax incl.)

Urotensin II, mouse is an endogenous ligand for the orphan G-protein-coupled receptor GPR14 or SENR. Urotensin II, mouse is a potent vasoconstrictor. Urotensin II, mouse plays a physiological role in the central...