Category: Peptides

Filter By
Glycyl-L-glutamic acid Glycyl-L-glutamic acid

Glycyl-L-glutamic acid

Reference: HY-W014700
€0.00 (tax incl.)
Glycyl-L-glutamic acid is a neurotrophic factor (NF) in vivo, and exerts function of maintenance of AChE content and activity. Glycyl-L-glutamic acid doesn’t act directly on AChE synthesis, and may prevent...
Cyclic somatostatin Cyclic somatostatin

Cyclic somatostatin

Reference: HY-P0084
€0.00 (tax incl.)
Cyclic somatostatin (SRIF-14) is a growth hormone-release inhibiting factor used in the research of severe, acute hemorrhages of gastroduodenal ulcers. Cyclic somatostatin is a neuropeptide co-stored with...
Fmoc-Phe(4-NH2)-OH Fmoc-Phe(4-NH2)-OH

Fmoc-Phe(4-NH2)-OH

Reference: HY-W010982
€0.00 (tax incl.)
Fmoc-Phe(4-NH2)-OH is a phenylalanine derivative.
Boc-Tyr(Me)-OH Boc-Tyr(Me)-OH

Boc-Tyr(Me)-OH

Reference: HY-W009258
€0.00 (tax incl.)
Boc-Tyr(Me)-OH is a tyrosine derivative.
Boc-Ser(Tos)-OMe Boc-Ser(Tos)-OMe

Boc-Ser(Tos)-OMe

Reference: HY-79877
€0.00 (tax incl.)
Boc-Ser(Tos)-OMe is a serine derivative.
Piscidin-1 (22-42) (TFA) Piscidin-1 (22-42) (TFA)

Piscidin-1 (22-42) (TFA)

Reference: HY-P1954A
€0.00 (tax incl.)
Piscidin-1 (22-42) (TFA) is a highly potent, multi-functional Antimicrobial Peptide (AMP) produced by Orange-spotted grouper (Epinephelus coioides). Piscidin-1 (22-42) (TFA) has many functional usages including...
Fmoc-D-Gly(allyl)-OH Fmoc-D-Gly(allyl)-OH

Fmoc-D-Gly(allyl)-OH

Reference: HY-W013779
€0.00 (tax incl.)
Fmoc-D-Gly(allyl)-OH is a Glycine (HY-Y0966) derivative.
Tyrosinase (206-214), human Tyrosinase (206-214), human

Tyrosinase (206-214), human

Reference: HY-P3813
€0.00 (tax incl.)
Tyrosinase (206-214), human (AFLPWHRLF), a 9-amino acid peptide, is a tyrosinase epitope. Tyrosinase (206-214), human can be recognized by HLA-A24 restricted, tumor-infiltrating lymphocytes (TIL).
Fmoc-Asp(OtBu)-OH Fmoc-Asp(OtBu)-OH

Fmoc-Asp(OtBu)-OH

Reference: HY-Y1169
€0.00 (tax incl.)
Fmoc-Asp(OtBu)-OH (4-tert-Butyl N-(fluoren-9-ylmethoxycarbonyl)-L-aspartate) is a aspartate derivative containing amine protecting group Fmoc. Fmoc-Asp(OtBu)-OH can be used for peptide synthesis.
[Tyr8]-Atrial Natriuretic Peptide (5-27), rat [Tyr8]-Atrial Natriuretic Peptide (5-27), rat

[Tyr8]-Atrial Natriuretic Peptide (5-27), rat

Reference: HY-P3774
€0.00 (tax incl.)
[Tyr8]-Atrial Natriuretic Peptide (5-27), rat is an atrial natriuretic peptide (ANP) analog that relaxes smooth muscle without affecting cGMP levels.
Big Endothelin-1 (1-38), human Big Endothelin-1 (1-38), human

Big Endothelin-1 (1-38), human

Reference: HY-P2538
€0.00 (tax incl.)
Big Endothelin-1 (1-38), human is the precursor of endothelin-1. Endothelin-1 (ET-1) is a potent vasopressor peptide.
Cyclic MKEY TFA Cyclic MKEY TFA

Cyclic MKEY TFA

Reference: HY-P1949A
€0.00 (tax incl.)
Cyclic MKEY TFA is a synthetic cyclic peptide inhibitor of CXCL4-CCL5 heterodimer formation, which protects against atherosclerosis and aortic aneurysm formation by mediating inflammation. Cyclic MKEY TFA also...
Cecropin B Cecropin B

Cecropin B

Reference: HY-P0092
€0.00 (tax incl.)
Cecropin B has high level of antimicrobial activity and is considered as a valuable peptide antibiotic.
H-Ile-OtBu.HCl H-Ile-OtBu.HCl

H-Ile-OtBu.HCl

Reference: HY-W009734
€0.00 (tax incl.)
H-Ile-OtBu.HCl is an isoleucine derivative.
Tyr-W-MIF-1 Tyr-W-MIF-1

Tyr-W-MIF-1

Reference: HY-P3087
€0.00 (tax incl.)
Tyr-W-MIF-1 is an opioid tetrapeptide with opiate and antiopiate activity. Tyr-W-MIF-1 can induce analgesia.
Splenopentin diacetate Splenopentin diacetate

Splenopentin diacetate

Reference: HY-P0085
€0.00 (tax incl.)
Splenopentin diacetate is a synthetic immunomodulating pentapeptide corresponding to the residues 32-36 of the splenic hormone splenin. Splenopentin diacetate influences both early T and B cell differentiation, to...
Cys(Npys)-(D-Arg)9 Cys(Npys)-(D-Arg)9

Cys(Npys)-(D-Arg)9

Reference: HY-P4099
€0.00 (tax incl.)
Cys(Npys)-(D-Arg)9 is an amphipathic R9 cell penetrating peptide (CPP). Cys(Npys)-(D-Arg)9 has cytotoxicity for microspore cells with the amount higher than 1 nmol.
PQDVKFP PQDVKFP

PQDVKFP

Reference: HY-P3590
€0.00 (tax incl.)
PQDVKFP is a synthetic peptide, recognizing antigenic domains within the hepatitis C virus (HCV) core protein.
H-Met-Thr-OH H-Met-Thr-OH

H-Met-Thr-OH

Reference: HY-P4438
€0.00 (tax incl.)
H-Met-Thr-OH is a dipeptide.
Fmoc-HoPro-OH Fmoc-HoPro-OH

Fmoc-HoPro-OH

Reference: HY-W013190
€0.00 (tax incl.)
Fmoc-HoPro-OH is a proline derivative.
DSTYSLSSTLTLSK DSTYSLSSTLTLSK

DSTYSLSSTLTLSK

Reference: HY-P3203
€0.00 (tax incl.)
DSTYSLSSTLTLSK is a generic human peptide and can be used for infliximab quantitative detection. Infliximab (Avakine) is a chimeric monoclonal IgG1 antibody that specifically binds to TNF-α.
WRW4 WRW4

WRW4

Reference: HY-P1119
€0.00 (tax incl.)
WRW4, a specific formyl peptide receptor-like 1 (FPRL1) antagonist, inhibits WKYMVm binding to FPRL1 with an IC50 of 0.23 μM. WRW4 specifically inhibits the increase in intracellular calcium by the FPRL1 agonists...
PHI-27 (rat) PHI-27 (rat)

PHI-27 (rat)

Reference: HY-P3040
€0.00 (tax incl.)
PHI-27 (rat) is a 27 amino acid peptide.PHI-27 (rat) is used to find peptide hormones and other active peptides.
Dimethyl L-glutamate Dimethyl L-glutamate

Dimethyl L-glutamate

Reference: HY-W037817
€0.00 (tax incl.)
Dimethyl L-glutamate (Dimethyl glutamate), a membrane-permeable analog of Glutamate, can stimulate insulin release induced by Glucose. Dimethyl L-glutamate suppresses the KATP channel activities. Dimethyl L-glutamate...
HAE HAE

HAE

Reference: HY-P1232
€0.00 (tax incl.)
HAE is a 3-amino acid peptide which consists of histidine, alanine and glutamate.
Boc-Leu-Gly-Arg-AMC Boc-Leu-Gly-Arg-AMC

Boc-Leu-Gly-Arg-AMC

Reference: HY-P2237
€0.00 (tax incl.)
Boc-Leu-Gly-Arg-AMC is a fluorogenic AMC substrate for the convertases. Boc-Leu-Gly-Arg-AMC can be used in enzymatic assays.
Semastatin 5A.1 Semastatin 5A.1

Semastatin 5A.1

Reference: HY-P4017
€0.00 (tax incl.)
Semastatin 5A.1 is an anti-angiogenic 19-amino acid peptides that are derived from proteins containing type I thrombospondin motifs.
Leptin (22-56), human Leptin (22-56), human

Leptin (22-56), human

Reference: HY-P1523
€0.00 (tax incl.)
Leptin (22-56), human is the fragment of leptin, mediated via several isoforms of receptors (Ob-Rs).
Rac1 Inhibitor W56 TFA Rac1 Inhibitor W56 TFA

Rac1 Inhibitor W56 TFA

Reference: HY-P1382A
€0.00 (tax incl.)
Rac1 Inhibitor W56 TFA is a peptide containing residues 45-60 of Rac1. Rac1 Inhibitor W56 TFA inhibits Rac1 interaction with guanine nucleotide exchange factors TrioN, GEF-H1, and Tiam.
MR 409 MR 409

MR 409

Reference: HY-P3304
€0.00 (tax incl.)
MR 409 is a selected growth hormone-releasing hormone (GHRH) agonist. MR 409 has remarkable neuroprotective effects through enhancing endogenous neurogenesis in cerebral ischemic mice. MR 409 also inhibits the in vivo...
Fmoc-D-4-Pal-OH Fmoc-D-4-Pal-OH

Fmoc-D-4-Pal-OH

Reference: HY-W009023
€0.00 (tax incl.)
Fmoc-D-4-Pal-OH is an alanine derivative.
Urocortin III, mouse Urocortin III, mouse

Urocortin III, mouse

Reference: HY-P1858
€0.00 (tax incl.)
Urocortin III, mouse is a corticotropin-releasing factor (CRF)-related peptide. Urocortin III preferentially binds and activates CRF-R2. Urocortin III (Ucn3) is a known component of the behavioral stress response...
GHRF, ovine GHRF, ovine

GHRF, ovine

Reference: HY-P3056
€0.00 (tax incl.)
GHRF, ovine is a growth hormone-releasing factor. GHRF is a specific mediator for the effects of hypoglycemia upon the release of pituitary growth hormone (GH).
N-Fmoc-O-ethyl-L-homoserine N-Fmoc-O-ethyl-L-homoserine

N-Fmoc-O-ethyl-L-homoserine

Reference: HY-W036160
€0.00 (tax incl.)
N-Fmoc-O-ethyl-L-homoserine is an homoserine derivative, can be used in cyclic peptide compounds synthesis, as a reducing reagent.
Tumor targeted pro-apoptotic peptide Tumor targeted pro-apoptotic peptide

Tumor targeted pro-apoptotic peptide

Reference: HY-P3707
€0.00 (tax incl.)
Tumor targeted pro-apoptotic peptide (CNGRC-GG-D(KLAKLAK)2) is an anti-tumor peptide. Tumor targeted pro-apoptotic peptide disrupts mitochondrial membranes and promotes apoptosis, showing anticancer activity in mice.
CD31 TFA CD31 TFA

CD31 TFA

Reference: HY-P3444A
€0.00 (tax incl.)
CD31 (PECAM-1) TFA is platelet endothelial cell adhesion molecule-1, serves as the endothelial cell-specific receptor of clostridium perfringens b-Toxin (CPB). CD31 TFA is also an ER-MP12 antigen, acts as a linker...
Cholecystokinin-33 (swine) Cholecystokinin-33 (swine)

Cholecystokinin-33 (swine)

Reference: HY-P3652
€0.00 (tax incl.)
Cholecystokinin-33 (swine) is a cholecystokinin (CCK) fragment. Cholecystokinin-33 (swine) can reduce food intake and gallbladder contraction.
Interleukin (IL)-6 Receptor Interleukin (IL)-6 Receptor

Interleukin (IL)-6 Receptor

Reference: HY-P0317
€0.00 (tax incl.)
Interleukin (IL)-6 Receptor is a peptide, derived from interleukin-6 receptor.
Humanin Humanin

Humanin

Reference: HY-P1928
€0.00 (tax incl.)
Humanin, an anti-apoptotic peptide of 24 amino acids, is a Bax inhibitor. Humanin prevents the translocation of Bax from cytosol to mitochondria, blocks Bax from the inactive to active conformation. Humanin is a...
Mca-Pro-Leu-Gly-Pro-D-Lys(Dnp) Mca-Pro-Leu-Gly-Pro-D-Lys(Dnp)

Mca-Pro-Leu-Gly-Pro-D-Lys(Dnp)

Reference: HY-P3792
€0.00 (tax incl.)
Mca-Pro-Leu-Gly-Pro-D-Lys(Dnp) is a FRET substrate of Thimet oligopeptidase. Mca-Pro-Leu-Gly-Pro-D-Lys(Dnp) can be used for the determination of Thimet oligopeptidase activity.
GAGGVGKSAL GAGGVGKSAL

GAGGVGKSAL

Reference: HY-P3485
€0.00 (tax incl.)
GAGGVGKSAL is a wild-type KRAS G12D 10mer peptide. GAGGVGKSAL can be used as an immunogenic neoantigen for cancer immunotherapy research.
Penetratin-Arg Penetratin-Arg

Penetratin-Arg

Reference: HY-P4117
€0.00 (tax incl.)
Penetratin-Arg is an antimicrobial and is used for drug delivery vehicle.
Recombinant Proteinase K Recombinant Proteinase K

Recombinant Proteinase K

Reference: HY-P3150
€0.00 (tax incl.)
Recombinant Proteinase K is a serine protease that cleaves the carboxy-terminated peptide bonds of aliphatic and aromatic amino acids. Recombinant Proteinase K can be used to digest proteins and remove contamination...
Locustatachykinin I Locustatachykinin I

Locustatachykinin I

Reference: HY-P1183
€0.00 (tax incl.)
Locustatachykinin I is a insect tachykinin-related peptide isolated from Locusta migratoria. Locustatachykinin I exhibits sequence homologies with the vertebrate tachykinins. In Lacanobia, Locustatachykinin I is also...
Secretin, porcine Secretin, porcine

Secretin, porcine

Reference: HY-P1535
€0.00 (tax incl.)
Secretin, porcine (Porcine secretin acetate) is a 27-amino acid peptide, acting on pancreatic acinar cells and ductal epithelial cells stimulating the production of bicarbonate rich fluid.
TRAF6 control peptide TRAF6 control peptide

TRAF6 control peptide

Reference: HY-P3708
€0.00 (tax incl.)
TRAF6 control peptide is a control peptide for TRAF6.
Methyl L-valinate Methyl L-valinate

Methyl L-valinate

Reference: HY-W037443
€0.00 (tax incl.)
Methyl L-valinate is a valine derivative.
Neuropeptide Y (3-36) (porcine) Neuropeptide Y (3-36) (porcine)

Neuropeptide Y (3-36) (porcine)

Reference: HY-P3676
€0.00 (tax incl.)
Neuropeptide Y (3-36) (porcine) is an agonist of neuropeptide Y (NPY) receptor subtype Y2, and stimulates feeding in rats. Neuropeptide Y (3-36) (porcine) is a highly Y2 selective ligand compared with nselective Y1/Y2...
Cecropin A (1-7)-Melittin A (2-9) Cecropin A (1-7)-Melittin A (2-9)

Cecropin A (1-7)-Melittin A (2-9)

Reference: HY-P3914
€0.00 (tax incl.)
Cecropin A (1-7)-Melittin A (2-9) is an antimicrobial peptide with antimicrobial activity against a broad spectrum of Gram-positive and Gram-negative aerobic bacteria, as well as antimalarial activity, without the...
Lactoferrin (17-41) (acetate) Lactoferrin (17-41) (acetate)

Lactoferrin (17-41) (acetate)

Reference: HY-P1791B
€0.00 (tax incl.)
Lactoferrin 17-41 (Lactoferricin B) acetate, a peptide corresponding to residues 17-41 of bovine lactoferrin, has antimicrobial activity against a wide range of microorganisms, including Gram-positive and Gramnegative...
Retrobradykinin Retrobradykinin

Retrobradykinin

Reference: HY-P2039
€0.00 (tax incl.)
Retrobradykinin has the reverse sequence of Bradykinin (HY-P0206). Retrobradykinin exhibits no kinin activity and can be used as a negative control for Bradykinin.
MBP MAPK Substrate MBP MAPK Substrate

MBP MAPK Substrate

Reference: HY-P2456
€0.00 (tax incl.)
MBP MAPK Substrate is used as an exogenous substrate for MAPK.
ANP (1-30), frog ANP (1-30), frog

ANP (1-30), frog

Reference: HY-P3762
€0.00 (tax incl.)
ANP (1-30), frog is a peptide fragment of atrial natriuretic peptide derived from frog. ANP (1-30), frog has natriuretic, diuretic, and vasorelaxant effects.
Protein Kinase C (19-31) Protein Kinase C (19-31)

Protein Kinase C (19-31)

Reference: HY-P1746
€0.00 (tax incl.)
Protein Kinase C (19-31), a peptide inhibitor of protein kinase C (PKC), derived from the pseudo-substrate regulatory domain of PKCa (residues 19-31) with a serine at position 25 replacing the wild-type alanine, is...
Apelin-13 TFA Apelin-13 TFA

Apelin-13 TFA

Reference: HY-P1944A
€0.00 (tax incl.)
Apelin-13 TFA is an endogenous ligand for the G-protein coupled receptor angiotensin II protein J (APJ), activating this G protein-coupled receptor with an EC 50 value of 0.37 nM. Apelin-13 TFA has vasodilatory and...
Agitoxin-2 TFA Agitoxin-2 TFA

Agitoxin-2 TFA

Reference: HY-P1282A
€0.00 (tax incl.)
Agitoxin-2 TFA is a K+ channel inhibitor, with IC50 values of 201 pM and 144 pM for mKV1.3 and mKV1.1, respectively).
SAH-SOS1A SAH-SOS1A

SAH-SOS1A

Reference: HY-P2265
€0.00 (tax incl.)
SAH-SOS1A is a peptide-based SOS1/KRAS protein interaction inhibitor. SAH-SOS1A binds to wild-type and mutant KRAS (G12D, G12V, G12C, G12S, and Q61H) with nanomolar affinity (EC50=106-175 nM), directly and...
STh STh

STh

Reference: HY-P2695
€0.00 (tax incl.)
STh, an Escherichia coli heat-stable toxin, is a 19 amino acid polypeptide encompassing three disulfide bridges. STh is an antigen of interest in the search for a broad coverage enterotoxigenic Escherichia coli (ETEC)...
Z-Glu-OtBu Z-Glu-OtBu

Z-Glu-OtBu

Reference: HY-W008549
€0.00 (tax incl.)
Z-Glu-OtBu is a glutamic acid derivative.
β-Endorphin, equine β-Endorphin, equine

β-Endorphin, equine

Reference: HY-P1866
€0.00 (tax incl.)
β-Endorphin, equine is an endogenous opioid peptide, which binds at high affinity to both μ/δ opioid receptors. Analgesic properties.
CysHHC10 TFA CysHHC10 TFA

CysHHC10 TFA

Reference: HY-P1978A
€0.00 (tax incl.)
CysHHC10 TFA is a synthetic antimicrobial peptide (AMP), and exhibits strong anti-microbial properties against both Gram-positive and Gram-negative bacteria. The MIC values of CysHHC10 TFA against E. coli, P....
Mca-KKEDVV-Abu-C Mca-KKEDVV-Abu-C

Mca-KKEDVV-Abu-C

Reference: HY-P4023
€0.00 (tax incl.)
Mca-KKEDVV-Abu-C is a peptide. Mca-KKEDVV-Abu-C can be used for various biochemical researches.
H-D-Phe(4-Me)-OH H-D-Phe(4-Me)-OH

H-D-Phe(4-Me)-OH

Reference: HY-W042007
€0.00 (tax incl.)
H-D-Phe(4-Me)-OH is a phenylalanine derivative.
Chlorotoxin Chlorotoxin

Chlorotoxin

Reference: HY-P0173A
€0.00 (tax incl.)
Chlorotoxin is a 36 amino-acid peptide from the venom of the Israeli scorpion Leiurus quinquestriatus with anticancer activity. Chlorotoxin is a chloride channel blocker.
CTOP CTOP

CTOP

Reference: HY-P1329
€0.00 (tax incl.)
CTOP is a potent and highly selective μ-opioid receptor antagonist. CTOP antagonizes the acute morphine-induced analgesic effect and hypermotility. CTOP enhances extracellular dopamine levels in the nucleus accumbens....
[Phe2]-TRH [Phe2]-TRH

[Phe2]-TRH

Reference: HY-P3962
€0.00 (tax incl.)
[Phe2]-TRH is a thyrotropin releasing hormone analogue, equipping a conformational similarity with Leu5-enkephalin.
Peptide C105Y TFA Peptide C105Y TFA

Peptide C105Y TFA

Reference: HY-P1781A
€0.00 (tax incl.)
Peptide C105Y TFA, a synthetic and cell-penetrating peptide based on the amino acid sequence corresponding to residues 359-374 of α1-antitrypsin, enhances gene expression from DNA nanoparticles.
Furin Substrate Furin Substrate

Furin Substrate

Reference: HY-P3797
€0.00 (tax incl.)
Furin Substrate is an peptide. Furin Substrate can be used for the research of various biochemical.
Chlorotoxin(linear) Chlorotoxin(linear)

Chlorotoxin(linear)

Reference: HY-P0173
€0.00 (tax incl.)
Chlorotoxin(linear) is a linear 36 amino-acid peptide which can be used in Chlorotoxin related research.
δ-Sleep Inducing Peptide δ-Sleep Inducing Peptide

δ-Sleep Inducing Peptide

Reference: HY-P1501
€0.00 (tax incl.)
δ-Sleep Inducing Peptide is a neuropeptide, with antioxidant and anxiolytic properties.
DPDPE DPDPE

DPDPE

Reference: HY-P1334
€0.00 (tax incl.)
DPDPE, an opioid peptide, is a selective δ-opioid receptor (DOR) agonist with anticonvulsant effects.
Galanin Receptor Ligand M35 TFA Galanin Receptor Ligand M35 TFA

Galanin Receptor Ligand M35 TFA

Reference: HY-P1840A
€0.00 (tax incl.)
Galanin Receptor Ligand M35 TFA is a high-affinity ligand and antagonist of galanin receptor (Kd=0.1 nM). Galanin Receptor Ligand M35 TFA exerts a Ki values of 0.11 and 2.0 nM for human galanin receptor type 1 and 2,...
SALMF amide 1 SALMF amide 1

SALMF amide 1

Reference: HY-P2042
€0.00 (tax incl.)
SALMF amide 1 is a neuropeptide.
SV40 T-Ag-derived NLS peptide SV40 T-Ag-derived NLS peptide

SV40 T-Ag-derived NLS peptide

Reference: HY-P1877
€0.00 (tax incl.)
SV40 T-Ag-derived NLS peptide is a nuclear localization signal DNA tagged to this peptide efficiently translocates into the cell nucleus.
VSGLNPSLWSIFGLQFILLWLVSGSRHYLW TFA VSGLNPSLWSIFGLQFILLWLVSGSRHYLW TFA

VSGLNPSLWSIFGLQFILLWLVSGSRHYLW TFA

Reference: HY-P3431A
€0.00 (tax incl.)
VSGLNPSLWSIFGLQFILLWLVSGSRHYLW (TFA) is a 30-amino-acid peptide mimicking the C-terminal domain of α2δ-1, termed as α2δ-1Tat peptide. VSGLNPSLWSIFGLQFILLWLVSGSRHYLW can effectively interrupt the α2δ-1 - NMDAR...
G2-Peptide G2-Peptide

G2-Peptide

Reference: HY-P3795
€0.00 (tax incl.)
G2-Peptide is an peptide. G2-Peptide can be used for the research of various biochemical.
GR 87389 GR 87389

GR 87389

Reference: HY-P3853
€0.00 (tax incl.)
GR 87389 is a potent NK2 receptor antagonist. GR 87389 antagonized GA 64349-induced smooth muscle strips contractions in a competitive manner in the human detrusor, prostate and prostatic urethra.
H3K27(Me3) (15-34) H3K27(Me3) (15-34)

H3K27(Me3) (15-34)

Reference: HY-P2254
€0.00 (tax incl.)
H3K27(Me3) (15-34), a histone peptide, is a repressive chromatin mark derived from human histone. Polycomb Repressive Complex 2 (PRC2) is a multiprotein complex that catalyzes the methylation of H3K27(Me).
H-Leu-OtBu.HCl H-Leu-OtBu.HCl

H-Leu-OtBu.HCl

Reference: HY-W008061
€0.00 (tax incl.)
H-Leu-OtBu.HCl is a leucine derivative.
[Leu5]-Enkephalin [Leu5]-Enkephalin

[Leu5]-Enkephalin

Reference: HY-P0288
€0.00 (tax incl.)
[Leu5]-Enkephalin is a pentapeptide with morphine like properties. [Leu5]-Enkephalin is a five amino acid endogenous peptide that acts as an agonist at opioid receptors.
SPR741 SPR741

SPR741

Reference: HY-P1649
€0.00 (tax incl.)
SPR741 (NAB741) is a cationic peptide derived from polymyxin B and is a potentiator molecule. SPR741 increases the permeability of the outer membrane of Gram-negative bacteria and is used to treat severe Gram-negative...
Cdk2/Cyclin Inhibitory Peptide II Cdk2/Cyclin Inhibitory Peptide II

Cdk2/Cyclin Inhibitory Peptide II

Reference: HY-P3731
€0.00 (tax incl.)
Cdk2/Cyclin Inhibitory Peptide II (Tat-LDL), a CDK2 inhibitor, kills U2OS osteosarcoma cells in a dose-dependent manner.
ACTH (3-24) (human, bovine, mouse, ovine, porcine, rabbit, rat) ACTH (3-24) (human, bovine, mouse, ovine, porcine, rabbit, rat)

ACTH (3-24) (human, bovine, mouse, ovine, porcine, rabbit, rat)

Reference: HY-P3977
€0.00 (tax incl.)
ACTH (3-24) (human, bovine, mouse, ovine, porcine, rabbit, rat) is the 3-24 fragment of adrenocorticotropic hormone (ACTH). ACTH (3-24) (human, bovine, mouse, ovine, porcine, rabbit, rat) can be used for research of a...
Insulin degludec Insulin degludec

Insulin degludec

Reference: HY-108743
€0.00 (tax incl.)
Insulin degludec is an ultra-long-acting form of insulin used for the research of hyperglycemia caused by type 1 and type 2 dabetes. Insulin degludec shows binding efficiency with an IC50 value of 19.59 nM for insulin...

Menu

Settings

Please sign in first.

Sign in