Category: Peptides

Filter By
Brand: Abbexa Brand: Agrisera Brand: ApexBio Brand: Biosensis Brand: Chromotek Brand: MedChemExpress  Brand: Signalchem Clear all
EIF2S Peptide EIF2S Peptide

EIF2S Peptide

Reference: E23-58
€0.00 (tax incl.)
The 13 amino acids of EIF2S peptide sequence (CILLSELSRRRIR) is derived from human protein EIF2S1 between residues 46-57. This peptide is suitable for use as a substrate for MNK1 and EIF2AK family kinases.
GRKtide GRKtide

GRKtide

Reference: G46-58
€0.00 (tax incl.)
The synthetic peptide sequence (CRRREEEEESAAA) is routinely evaluated as a substrate for GRK family kinases, including GRK2, GRK3, GRK4 and GRK7.
GS Peptide GS Peptide

GS Peptide

Reference: G60-58
€0.00 (tax incl.)
The GS peptide sequence (PLSRTLSVSS) is derived from an N-terminus of glycogen synthase and is suitable for use as the substrate for DCAMKL1 and CAMKII family.
Histone H1 Peptide Histone H1 Peptide

Histone H1 Peptide

Reference: H10-58-1
€0.00 (tax incl.)
The Histone H1 Peptide (152-159) sequence (GGGPATP-KKAKKL-COOH) is derived from human histone H1 between amino acids 152-159 and is suitable for use as the substrate for CDK family kinase assays, such as CDK1, CDK2,...
Histone H3 Peptide (1-21) Histone H3 Peptide (1-21)

Histone H3 Peptide (1-21)

Reference: H12-58-500
€0.00 (tax incl.)
The Histone H3 Peptide (1-21) sequence (ARTKQTARKS-TGGKAPRKQLAGGKKC) is derived from human histone H3 (1-21) and is suitable for use as the substrate for histone methyltransferase (at K4 and K9) and acetyltransferase...
Histone H3 Peptide (1-21) Histone H3 Peptide (1-21)

Histone H3 Peptide (1-21)

Reference: H12-58-01
€0.00 (tax incl.)
The Histone H3 Peptide (1-21) sequence (ARTKQTARKS-TGGKAPRKQLAGGKKC) is derived from human histone H3 (1-21) and is suitable for use as the substrate for histone methyltransferase (at K4 and K9) and acetyltransferase...
Histone H4 Peptide (1-21) Histone H4 Peptide (1-21)

Histone H4 Peptide (1-21)

Reference: H13-58-500
€0.00 (tax incl.)
The Histone H4 Peptide (1-21) sequence (SGRGKGGKGL-GKGGAKRHRKVGGKKC) is derived from human histone H4 (1-21) and is suitable for use as the substrate for histone methyltransferase (at R3) and acetyltransferase (at K5,...
Histone H4 Peptide (1-21) Histone H4 Peptide (1-21)

Histone H4 Peptide (1-21)

Reference: H13-58-01
€0.00 (tax incl.)
The Histone H4 Peptide (1-21) sequence (SGRGKGGKGL-GKGGAKRHRKVGGKKC) is derived from human histone H4 (1-21) and is suitable for use as the substrate for histone methyltransferase (at R3) and acetyltransferase (at K5,...
HSP27tide HSP27tide

HSP27tide

Reference: H31-58
€0.00 (tax incl.)
The HSP27tide peptide sequence (RRLNRQLSVA-amide) is based on the mouse HSP27 (amino acid 80-85).
IGF1Rtide IGF1Rtide

IGF1Rtide

Reference: I15-58
€0.00 (tax incl.)
The 14 amino acids of IGF1Rtide peptide sequence (KKKSPGEYVNIEFG) is derived from human IRS-1 protein residues 891-902.
IKKtide IKKtide

IKKtide

Reference: I33-58
€0.00 (tax incl.)
The IKKtide peptide sequence (KKKKERLLDDRHDSG-LDSMKDEE) is derived from human IkBA (amino acids 21-41) and is suitable as a substrate for IKK alpha and IKK beta.
IRS1 (Y608) Peptide IRS1 (Y608) Peptide

IRS1 (Y608) Peptide

Reference: I40-58-1000
€0.00 (tax incl.)
The synthetic IRS1 (Y608) Peptide [KKHTDDGYMPMSPGVA] is derived from mouse insulin receptor substrate 1 (amino acids 603-616) and is suitable as substrate for JAK1 and JAK2.
JAK3tide JAK3tide

JAK3tide

Reference: J03-58-1000
€0.00 (tax incl.)
The JAK3tide synthetic peptide [GGEEEEYFELVKKKK] is routinely evaluated as a substrate for JAK3 and JAK2.
LKBtide LKBtide

LKBtide

Reference: L15-58
€0.00 (tax incl.)
The synthetic peptide LKBtide (LSNLYHQGKFLQTFCGSPLY-RRRC) is derived from human NUAK2 (amino acid 196-215) and can be phosphorylated by protein Serine/Threonine kinase 11 (STK11), also known as LKB1.
LRRKtide LRRKtide

LRRKtide

Reference: L10-58
€0.00 (tax incl.)
The LRRKtide peptide sequence (RLGRDKYKTLRQIRQ) is derived from human ezrin (amino acids 561-573), moesin (amino acids 539-553) and radixin (amino acids 558-570) and is suitable for use as a substrate for LRRK kinases.
MARCKS Peptide MARCKS Peptide

MARCKS Peptide

Reference: M02-58
€0.00 (tax incl.)
The synthetic peptide (KKRFSFKKSFKL) is derived from amino acid residues 154 –165 of protein myristoylated alanine-rich C-kinase substrate (MARCKS). This peptide is suitable for use as a substrate for PKC alpha, PKC...
Micro2 Peptide Micro2 Peptide

Micro2 Peptide

Reference: M08-58-1000
€0.00 (tax incl.)
The Micro2 Peptide sequence (KEEQSQITSQVTGQIGWR) is derived from human AP-2 complex subunit mu isoform b (amino acids 143-160) and is suitable as a substrate for AAK1, BMP2K, and GAK kinase assay.
MLC Peptide MLC Peptide

MLC Peptide

Reference: M09-58
€0.00 (tax incl.)
The MLC Peptide sequence (AKRPQRATSNVFS) represents the phosphate-accepting domain of human MYL9 (amino acids 12-23) and can be used as a substrate for PHKG1, PHKG2 and DAPK2.
Modified EIF2S Peptide Modified EIF2S Peptide

Modified EIF2S Peptide

Reference: E23-58B
€0.00 (tax incl.)
The Modified EIF2S Peptide sequence (Modified-CILLSELSRRRIR) is derived from human EIF2S1 (46-57) and is suitable for use as the substrate for EIF2AK kinase family and MNK1.
Modified PLKtide Modified PLKtide

Modified PLKtide

Reference: P41-58B
€0.00 (tax incl.)
The Modified PLKtide peptide sequence (Modified-CKKLGEDQAEEISDDLLEDSLSDEDE) is derived from the CDC25C protein sequence (182-204).
Modified SGKtide Modified SGKtide

Modified SGKtide

Reference: S08-58B
€0.00 (tax incl.)
The Modified SGKtide peptide sequence (Modified- CKKRNRRLSVA) contains serine protein kinase phosphorylation site and is evaluated as a substrate for SGK and NDR family kinases.
MRCL3 Peptide MRCL3 Peptide

MRCL3 Peptide

Reference: M56-58
€0.00 (tax incl.)
The synthetic substrate MRCL3 Peptide (KKRPQRATSN-VFAM-NH2) is derived from human myosin regulatory light chain MRCL3 (amino acid 11-24) and can be used for MLCK, MYLK2 and MYLK3 kinase assay.
PAKtide PAKtide

PAKtide

Reference: P08-58
€0.00 (tax incl.)
The 10 amino acids of PAKtide peptide (RRRLSFAEPG) contain a serine/threonine protein kinase phosphorylation site in a common seven-residue epitope (1, 2).
PDHKtide PDHKtide

PDHKtide

Reference: P57-58
€0.00 (tax incl.)
The synthetic peptide substrate PDHKtide (RRYHGHSMS-DPGVSYRTR) is derived from human PDHA1 protein (amino acid 288-304aa) and can be used for PDHK family kinase assay.
PDKtide PDKtide

PDKtide

Reference: P10-58
€0.00 (tax incl.)
The 39 amino acids of PDKtide peptide sequence (KTFCGTPEYLAPEVRREPRILSEEEQEMFRDFDYIADWC) is derived from two human proteins: residues 1-14 are based on AKT1 (307-320) and residues 16-39 are based on PKN2/PRK2 (961-984).
PKCtide PKCtide

PKCtide

Reference: P15-58
€0.00 (tax incl.)
The PKCtide peptide sequence (ERMRPRKRQGSVRRRV) is based on protein kinase C epsilon (amino acid 149-164).
PLKtide PLKtide

PLKtide

Reference: P41-58
€0.00 (tax incl.)
The PLKtide peptide sequence (CKKLGEDQAEEISDDLLED-SLSDEDE) is derived from the CDC25C protein sequence (182-204).
Poly (4:1 Glu, Tyr) Peptide Poly (4:1 Glu, Tyr) Peptide

Poly (4:1 Glu, Tyr) Peptide

Reference: P61-58
€0.00 (tax incl.)
The Poly (4:1 Glu, Tyr) substrate peptide is used as universal substrate for protein tyrosine kinases.
PS7-CTD Peptide PS7-CTD Peptide

PS7-CTD Peptide

Reference: R06-58-
€0.00 (tax incl.)
The PS7-CTD peptide sequence (YSPTS PpSYSP TSPpS) is derived from C-terminal repeat domain of human RNA polymerase II.
RS Repeat Peptide RS Repeat Peptide

RS Repeat Peptide

Reference: R55-58
€0.00 (tax incl.)
The synthetic peptide (GRSRSRSRSRSRSRSR) contains serine/threonine protein kinase phosphorylation sites and is routinely evaluated as a substrate for CLK, EIF2AK and SRPK family kinases.
SAMStide SAMStide

SAMStide

Reference: S07-58
€0.00 (tax incl.)
The SAMStide peptide sequence (HMRSAMSGLHLVKRR) is based on the mouse acetyl-Coenzyme A carboxylase alpha (amino acid 73-85).
SGKtide SGKtide

SGKtide

Reference: S08-58
€0.00 (tax incl.)
The SGKtide peptide sequence (CKKRNRRLSVA) contains serine protein kinase phosphorylation site and is evaluated as a substrate for SGK and NDR family kinases.
TGFBR1 Peptide TGFBR1 Peptide

TGFBR1 Peptide

Reference: T36-58
€0.00 (tax incl.)
The TGFBR1 peptide sequence (KKKVLTQMGSPSIRC-S(pS)VS) is derived from human SMAD3 (215-230) and is suitable for use as the substrate for TGFBR1 superfamily, including ACVRs (ALK1, ALK2, ALK4 and ALK7) and BMPRs (ALK3...
Thr-phosphopeptide Thr-phosphopeptide

Thr-phosphopeptide

Reference: T69-58
€0.00 (tax incl.)
The Thr-phosphopeptide sequence (KRT(p)IRR) is derived from human NR2F6 (amino acids 79-84) and is suitable as a substrate for PP2A, PP2B, PP2C and PP1.
Thr-phosphopeptide-3 Thr-phosphopeptide-3

Thr-phosphopeptide-3

Reference: T72-58-01
€0.00 (tax incl.)
The Thr-phosphopeptide-3 sequence (RRAT(p)VA) is a phosphorylated threonyl derivative from human pyruvate kinase (amino acids 40-45) and is suitable as a substrate for PP1, PP2A, and PP2C (e.g. WIP1).
Tyr-phosphopeptide-2 Tyr-phosphopeptide-2

Tyr-phosphopeptide-2

Reference: T70-58
€0.00 (tax incl.)
The Tyr-phosphopeptide-2 sub peptide sequence (DADEY(p)LIPDQG) is based on mouse epidermal growth factor receptor isoform 1 (amino acid 1014-1024).
ULKtide ULKtide

ULKtide

Reference: U01-58-1
€0.00 (tax incl.)
The ULKtide synthetic peptide [YANWLAASIYLDGKKK] is routinely evaluated as a substrate for ULK family kinase assays.
ZIPtide ZIPtide

ZIPtide

Reference: Z16-58
€0.00 (tax incl.)
The ZIPtide substrate peptide sequence (KKLNRTLSFAEPG) is routinely evaluated as a substrate for DAPK3 (ZIPK).
Amyloid beta, 1-42, HFIP-treated Purified Peptide-50 μg Amyloid beta, 1-42, HFIP-treated Purified Peptide-50 μg

Amyloid beta, 1-42, HFIP-treated Purified Peptide-50 μg

Reference: PE-1749-50
€0.00 (tax incl.)
Synthetic beta-amyloid Aβ1-42 was monomerized by HFIP (hexafluoro-2-propanol) treatment and dried. One vial contains 50 μg monomeric Aβ peptide that can be used to form solutions of unaggregated Aβ monomers,...
Amyloid beta, 1-42, oligomeric, Stabilized Peptide-2 x 500 ng Amyloid beta, 1-42, oligomeric, Stabilized Peptide-2 x 500 ng

Amyloid beta, 1-42, oligomeric, Stabilized Peptide-2 x 500 ng

Reference: PE-1750-1000
€0.00 (tax incl.)
A proprietary preparation of human amyloid beta peptide (amino acids 1-42) that was initially monomerized by HFIP-treatment and then allowed to form oligomers by the procedure described in Youmans KL et al., 2012,...
Z-Val-Gly-OH Z-Val-Gly-OH

Z-Val-Gly-OH

Reference: HY-W048830
€0.00 (tax incl.)
Z-Val-Gly-OH is a N-benzyloxycarbonyl (Z)-dipeptide.
Z-VEID-FMK Z-VEID-FMK

Z-VEID-FMK

Reference: HY-P1007
€0.00 (tax incl.)
Z-VEID-FMK is a selective inhibitor of caspase-6. Z-VEID-FMK can be used for the research of tumor.
Hexa-His TFA Hexa-His TFA

Hexa-His TFA

Reference: HY-P0294A
€0.00 (tax incl.)
Hexa-His TFA is a peptide consisting of 6 His residues, used as a metal binding site for the recombinant protein.
Insulin icodec Insulin icodec

Insulin icodec

Reference: HY-P4070
€0.00 (tax incl.)
Insulin icodec is a basal insulin analog. Insulin icodec can be used for the research of type 2 diabetes.
mTRP-2 (180-188) mTRP-2 (180-188)

mTRP-2 (180-188)

Reference: HY-P1827
€0.00 (tax incl.)
mTRP-2 (180-188) is a murine tyrosinase-related protein 2 (TRP-2) -derived peptide, corresponding to residues 180-188. TRP-2 (180-188) is identified as the major reactive epitope within TRP-2 recognized by anti-B16 CTLs.
Shepherdin (79-87) Shepherdin (79-87)

Shepherdin (79-87)

Reference: HY-P1750
€0.00 (tax incl.)
Shepherdin (79-87) is amino acids 79 to 87 fragment of Shepherdin. Shepherdin is a peptidomimetic antagonist of the complex between Hsp90 and Survivin. Anticancer activity.
Human PD-L1 inhibitor I Human PD-L1 inhibitor I

Human PD-L1 inhibitor I

Reference: HY-P2474
€0.00 (tax incl.)
Human PD-L1 inhibitor I is a hPD-1 peptide ligand, with a KD of 3.39 μM. Human PD-L1 inhibitor I may disturb the binding of hPD-L1 to hPD-1.
K41498 K41498

K41498

Reference: HY-P1106
€0.00 (tax incl.)
K41498 is a potent and highly selective CRF2 receptor antagonist with Ki values of 0.66 nM, 0.62 nM and 425 nM for human CRF2α, CRF2β and CRF1 receptors respectively. K41498 is an analogues of antisauvagine-30...
Fmoc-Asp(OtBu)-Osu Fmoc-Asp(OtBu)-Osu

Fmoc-Asp(OtBu)-Osu

Reference: HY-137950
€0.00 (tax incl.)
Fmoc-Asp(OtBu)-Osu is an aspartic acid derivative.
FOXO4-DRI FOXO4-DRI

FOXO4-DRI

Reference: HY-P4157
€0.00 (tax incl.)
FOXO4-DRI is a cell-permeable peptide antagonist that blocks the interaction of FOXO4 and p53. FOXO4-DRI is a senolytic peptide that induces apoptosis of senescent cells.
Alamandine Alamandine

Alamandine

Reference: HY-P3108
€0.00 (tax incl.)
Alamandine, a member of the renin-angiotensin system (RAS), a vasoactive peptide, is an endogenous ligand of the G protein-coupled receptor MrgD. Alamandine targets to protect the kidney and heart through...
Pyr-Arg-Thr-Lys-Arg-AMC TFA Pyr-Arg-Thr-Lys-Arg-AMC TFA

Pyr-Arg-Thr-Lys-Arg-AMC TFA

Reference: HY-P4349A
€0.00 (tax incl.)
Pyr-Arg-Thr-Lys-Arg-AMC TFA is a AMC peptide. AMC is a decapeptide that is specifically hydrolyzed by proteases such as trypsin and thrombin. The AMC peptide can be used to determine the activity of protease and the...
Felypressin acetate Felypressin acetate

Felypressin acetate

Reference: HY-A0182A
€0.00 (tax incl.)
Felypressin acetate (PLV-2 acetate) is a non-catecholamine vasoconstrictor and a vasopressin 1 agonist. Felypressin acetate is widely used in dental procedures.
BeKm-1 TFA BeKm-1 TFA

BeKm-1 TFA

Reference: HY-P1440A
€0.00 (tax incl.)
BeKm-1 TFA is a potent and selective KV11.1 (hERG) channel blocker. BeKm-1 TFA is selective for KV11.1 over a panel of 14 other potassium channels. BeKm-1 TFA dose-dependently prolongs QTc interval in isolated rabbit...
Fmoc-Met-OH Fmoc-Met-OH

Fmoc-Met-OH

Reference: HY-W008371
€0.00 (tax incl.)
Fmoc-Met-OH is a Methionine (HY-13694) derivative.
[Met5]-Enkephalin, amide TFA [Met5]-Enkephalin, amide TFA

[Met5]-Enkephalin, amide TFA

Reference: HY-P1467A
€0.00 (tax incl.)
[Met5]-Enkephalin, amide TFA is an agonist for δ opioid receptors as well as putative ζ (zeta) opioid receptors.
Glutathione oxidized Glutathione oxidized

Glutathione oxidized

Reference: HY-D0844
€0.00 (tax incl.)
Glutathione oxidized (GSSG) is produced by the oxidation of glutathione. Detoxification of reactive oxygen species is accompanied by production of glutathione oxidized. Glutathione oxidized can be used for the...
Fibronectin Fibronectin

Fibronectin

Reference: HY-P3160
€0.00 (tax incl.)
Fibronectin, a glycoprotein (~500 kDa) present in blood as well as in cells, is a biomarker of tissue injury. Fibronectin binds to membrane-spanning receptor proteins called integrins. Fibronectin also binds to other...
Substance P (6-11) Substance P (6-11)

Substance P (6-11)

Reference: HY-P3889
€0.00 (tax incl.)
Substance P (6-11) is the C-terminal hexapeptideamide of Substance P (Substance P (HY-P0201)). Substance P (6-11) binds to NK-1 tachykinin receptor. Substance P (6-11) shows depolarization of motoneurons and a...
H-Phg(4-Cl)-OH H-Phg(4-Cl)-OH

H-Phg(4-Cl)-OH

Reference: HY-W005720
€0.00 (tax incl.)
H-Phg(4-Cl)-OH (L-4-Chlorophenylglycine) is a Glycine (HY-Y0966) derivative.
Tat-NR2B9c Tat-NR2B9c

Tat-NR2B9c

Reference: HY-P0117
€0.00 (tax incl.)
Tat-NR2B9c (Tat-NR2Bct; NA-1) is a postsynaptic density-95 (PSD-95) inhibitor, with EC50 values of 6.7 nM and 670 nM for PSD-95d2 (PSD-95 PDZ domain 2) and PSD-95d1, respectively. Tat-NR2B9c disrupts the PSD-95/NMDAR...
Argipressin diacetate Argipressin diacetate

Argipressin diacetate

Reference: HY-P0049A
€0.00 (tax incl.)
Argipressin (diacetate) (AVP (diacetate), also known as antidiuretic hormone (ADH)) is a 9 amino acid neuropeptide secreted by the posterior pituitary. Argipressin (diacetate) (AVP (diacetate)) can regulate the...
Buforin II Buforin II

Buforin II

Reference: HY-P1630
€0.00 (tax incl.)
Buforin II, derived from buforin I, a protein isolated from the stomach of the Asian toad Bufo bufo gargarizans, is a potent antimicrobial peptide. Buforin II has antimicrobial activity against a broad spectrum of...
Dynorphin A Dynorphin A

Dynorphin A

Reference: HY-P1333
€0.00 (tax incl.)
Dynorphin A is an endogenous opioid peptide involved in inhibitory neurotransmission in the central nervous system (CNS). Dynorphin A is a highy potent kappa opioid receptor (KOR) agonist, and is also an agonist for...
Ala-Arg-Arg-Pro-Glu-Gly-Arg-Thr-Trp-Ala-Gln-Pro-Gly-Tyr Ala-Arg-Arg-Pro-Glu-Gly-Arg-Thr-Trp-Ala-Gln-Pro-Gly-Tyr

Ala-Arg-Arg-Pro-Glu-Gly-Arg-Thr-Trp-Ala-Gln-Pro-Gly-Tyr

Reference: HY-P3941
€0.00 (tax incl.)
Ala-Arg-Arg-Pro-Glu-Gly-Arg-Thr-Trp-Ala-Gln-Pro-Gly-Tyr is a peptide. Ala-Arg-Arg-Pro-Glu-Gly-Arg-Thr-Trp-Ala-Gln-Pro-Gly-Tyr can easily be formed with more than one positive charge.
p2Ca p2Ca

p2Ca

Reference: HY-P0260
€0.00 (tax incl.)
p2Ca, an 8-mer peptide, is a ligand that is naturally processed and presented to the Ld-alloreactive T cell clone, 2C.
Cys-Gly-Tyr-Gly-Pro-Lys-Lys-Lys-Arg-Lys-Val-Gly-Gly Cys-Gly-Tyr-Gly-Pro-Lys-Lys-Lys-Arg-Lys-Val-Gly-Gly

Cys-Gly-Tyr-Gly-Pro-Lys-Lys-Lys-Arg-Lys-Val-Gly-Gly

Reference: HY-P3827
€0.00 (tax incl.)
Cys-Gly-Tyr-Gly-Pro-Lys-Lys-Lys-Arg-Lys-Val-Gly-Gly is a13-mer synthetic peptide containing seven amino acids homologous to SV40 T antigen. Cys-Gly-Tyr-Gly-Pro-Lys-Lys-Lys-Arg-Lys-Val-Gly-Gly is capable of inducing...
Fmoc-Asp-OtBu Fmoc-Asp-OtBu

Fmoc-Asp-OtBu

Reference: HY-W010959
€0.00 (tax incl.)
Fmoc-Asp-OtBu is an aspartic acid derivative.
H-Ile-Pro-Pro-OH hydrochloride H-Ile-Pro-Pro-OH hydrochloride

H-Ile-Pro-Pro-OH hydrochloride

Reference: HY-114424A
€0.00 (tax incl.)
H-Ile-Pro-Pro-OH hydrochloride, a milk-derived peptide, inhibits angiotensin-converting enzyme (ACE) with an IC50 of 5 μM. Antihypertensive tripeptides.
GLP-1(32-36)amide GLP-1(32-36)amide

GLP-1(32-36)amide

Reference: HY-P3102
€0.00 (tax incl.)
GLP-1(32-36)amide, a pentapeptide, derived from the C terminus of the glucoregulatory hormone GLP-1. GLP-1(32-36)amide could inhibit weight gain and modulate whole body glucose metabolism in diabetic mice.
Phrixotoxin 3 Phrixotoxin 3

Phrixotoxin 3

Reference: HY-P1218
€0.00 (tax incl.)
Phrixotoxin 3 is a potent blocker of voltage-gated sodium channels, with IC50s of 0.6, 42, 72, 288, 610 nM for NaV1.2, NaV1.3, NaV1.4, NaV1.1 and NaV1.5, respectively. Phrixotoxin 3 modulates voltage-gated sodium...
Gly-Gly-Phe-Gly Gly-Gly-Phe-Gly

Gly-Gly-Phe-Gly

Reference: HY-P3669
€0.00 (tax incl.)
Gly-Gly-Phe-Gly is a peptide spacer and can be applied to Doxorubicin (HY-15142A) (DXR) conjugates.
α-Conotoxin PnIA α-Conotoxin PnIA

α-Conotoxin PnIA

Reference: HY-P1267
€0.00 (tax incl.)
α-Conotoxin PnIA, a potent and selective antagonist of the mammalian α7 nAChR, has the potential for the research of neurological conditions such as neuropathic pain and Alzheimer’s disease.
MEHFPGP MEHFPGP

MEHFPGP

Reference: HY-P1146
€0.00 (tax incl.)
MEHFPGP (Semax) is a nootropic neuroprotective peptide. MEHFPGP can be used in the research of brain stroke.
Melanotan (MT)-II Melanotan (MT)-II

Melanotan (MT)-II

Reference: HY-P0267
€0.00 (tax incl.)
Melanotan (MT)-II, a synthetic melanocortin receptor agonist, is an injectable peptide hormone used to promote tanning.
Fmoc-Lys(Tfa)-OH Fmoc-Lys(Tfa)-OH

Fmoc-Lys(Tfa)-OH

Reference: HY-W010830
€0.00 (tax incl.)
Fmoc-Lys(Tfa)-OH is a lysine derivative.
Colibactin Colibactin

Colibactin

Reference: HY-145930
€0.00 (tax incl.)
Colibactin is a complex secondary metabolite produced by some genotoxic gut Escherichia coli strains. Colibactin has the potential for the research of colorectal cancer[1].
C-telopeptide C-telopeptide

C-telopeptide

Reference: HY-P0284
€0.00 (tax incl.)
C-telopeptide, a cross-linked peptide of type I collagen, is released during bone resorption and has been correlated with bone mineral density (BMD).
SKF107457 SKF107457

SKF107457

Reference: HY-120880
€0.00 (tax incl.)
SKF107457 is an HIV-1 protease inhibitor that can be used in AIDS research.
M617 TFA M617 TFA

M617 TFA

Reference: HY-P1131A
€0.00 (tax incl.)
M617 TFA is a selective galanin receptor 1 (GAL1) agonist, with Kis of 0.23 and 5.71 nM for GAL1 and GAL2, respectively. M617 TFA, acting through its central GAL1, can promote GLUT4 expression and enhance GLUT4...
Fmoc-D-Glu(OtBu)-OH Fmoc-D-Glu(OtBu)-OH

Fmoc-D-Glu(OtBu)-OH

Reference: HY-Y1844
€0.00 (tax incl.)
Fmoc-D-Glu(OtBu)-OH is a glutamic acid derivative.
Mast cell degranulating peptide (28-49) Mast cell degranulating peptide (28-49)

Mast cell degranulating peptide (28-49)

Reference: HY-P1987
€0.00 (tax incl.)
Mast cell degranulating peptide (28-49) is a depolarizing agent from bee venom, it can raise the content of cGMP level in mouse cerebellar slices.
H-Asp(Obzl)-OtBu.HCl H-Asp(Obzl)-OtBu.HCl

H-Asp(Obzl)-OtBu.HCl

Reference: HY-W041996
€0.00 (tax incl.)
H-Asp(Obzl)-OtBu.HCl is an aspartic acid derivative.

Menu

Settings

Please sign in first.

Sign in