Filter By
Filter By
Category: Peptides
Filter By
Reference: HY-P1860
€0.00
(tax incl.)
TNF-α (31-45), human is a peptide of tumor necrosis factor-α.
Reference: HY-118349
€0.00
(tax incl.)
Dansylphenylalanine is a phenylalanine derivative.
Reference: HY-W011324
€0.00
(tax incl.)
(S)-2-((tert-Butoxycarbonyl)amino)-4-(cyclohexyloxy)-4-oxobutanoic acid is an aspartic acid derivative.
Reference: HY-P0329
€0.00
(tax incl.)
X-press Tag Peptide is a tag peptide used for protein purification. X-press Tag is also an N-terminal leader peptide; this N-terminal peptide contains a polyhistidine sequence, the Xpress epitope (part of...
Reference: HY-P3901
€0.00
(tax incl.)
[Leu8,D-Trp22,Tyr25] Somatostatin-28 is the analog of Somatostatin-28. Somatostatin-28 is a intestinal peptide containing somatostatin in its C-terminal portion.
Reference: HY-P2397
€0.00
(tax incl.)
Fmoc-Asn(Trt)-Thr(psi(Me,Me)pro)-OH is a dipeptide.
Reference: HY-P3968
€0.00
(tax incl.)
Thrombospondin-1 (1016-1021) (human, bovine, mouse), a Thrombospondin-1-derived peptide, is a truncated peptide devoid of CD47-binding activity.
Reference: HY-P1965
€0.00
(tax incl.)
Ac-IEVDIDV TFA is a short peptide sequence with Ac at the end.
Reference: HY-P2292A
€0.00
(tax incl.)
Omiganan-FITC TFA is a peptide-FITC complex composed of Omiganan and a FITC. Omiganan is a bactericidal and fungicidal cationic peptide being developed as a topical gel for prevention of catheter-associated infections.
Reference: HY-P1792A
€0.00
(tax incl.)
Angiotensin II (1-4), human (TFA) is an endogenous peptide produced from AT I by angiotensin-converting-enzyme (ACE). Angiotensin II binds the AT II type 1 (AT1) receptor, stimulating GPCRs in vascular smooth muscle...
Reference: HY-P2522
€0.00
(tax incl.)
Competence-Stimulating Peptide-2 (CSP-2) is a quorum sensing signal peptide produced by Streptococcus pneumoniae. ComD2 is a compatible receptor of Competence-Stimulating Peptide-2 (CSP-2) with an EC50 value of 50.7 nM.
Reference: HY-W013824
€0.00
(tax incl.)
Boc-D-Phe(3,4-DiF)-OH is a phenylalanine derivative.
Reference: HY-20861
€0.00
(tax incl.)
(R)-2-amino-3-cyclobutylpropanoic acid is an alanine derivative.
Reference: HY-P3278A
€0.00
(tax incl.)
Caloxin 2A1 TFA is an extracellular plasma membrane Ca2+-ATPase (PMCA) peptide inhibitor. Caloxin 2A1 TFA does not affect basal Mg2+-ATPase or Na+-K+-ATPase.
Reference: HY-34597
€0.00
(tax incl.)
(S)-2-Amino-3-(4-bromophenyl)propanoic acid is a phenylalanine derivative.
Reference: HY-P1924
€0.00
(tax incl.)
Interphotoreceptor retinoid-binding protein(668-687), the amino acid residues 668 to 687 of human interphotoreceptor retinoid binding protein (IRBP), induces uveitis.
Reference: HY-P2148
€0.00
(tax incl.)
P-113 is an antimicrobial peptide (AMP) derived from the human salivary protein histatin 5. P-113 is active against clinically important microorganisms such as Pseudomonas spp., Staphylococcus spp., and C. albicans.
Reference: HY-P1568
€0.00
(tax incl.)
Flagelin 22 (Flagellin 22), a fragment of bacterial flagellin, is an effective elicitor in both plants and algae.
Reference: HY-P2454
€0.00
(tax incl.)
CSP1 is a potent and selective ComD1 receptor agonist, with an IC50 of 10.3 nM. CSP1 is a major variants of competence-stimulating peptide (CSP), and it can regulate genetic transformation of S. pneumonia by...
Reference: HY-P1231
€0.00
(tax incl.)
GTFTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is an Exendin-4 peptide derivative.
Reference: HY-P1210A
€0.00
(tax incl.)
Lys-γ3-MSH(human) TFA is a melanocortin peptide derived from the C-terminal of the fragment of pro-opiomelanocortin (POMC). Lys-γ3-MSH(human) TFA potentiates the steroidogenic response of the rat adrenal to...
Reference: HY-P1390A
€0.00
(tax incl.)
d[Cha4]-AVP TFA is a potent and selective vasopressin (AVP) V1b receptor agonist with a Ki of 1.2 nM for human V1b receptor. d[Cha4]-AVP TFA shows more selective for V1b receptor than human V1a receptor, V2 receptor,...
Reference: HY-W008688
€0.00
(tax incl.)
Fmoc-L-Norleucine is a leucine derivative.
Reference: HY-W052310
€0.00
(tax incl.)
Methyl ((benzyloxy)carbonyl)-D-serinate is a serine derivative.
Reference: HY-P1844A
€0.00
(tax incl.)
Chemerin-9 (149-157) TFA is a potent agonist of chemokine-like receptor 1 (CMKLR1) . Chemerin-9 (149-157) TFA has anti-inflammatory activity. Chemerin-9 (149-157) TFA stimulates phosphorylation of Akt and ERK as well...
Reference: HY-P3591
€0.00
(tax incl.)
YMRF-NH2 is a neuropeptide. YMRF-NH2 binds to FMRFa-R with an EC50 value of 31 nM.
Reference: HY-P1428A
€0.00
(tax incl.)
RFRP-1(human) TFA is a potent endogenous NPFF receptor agonist (EC50 values are 0.0011 and 29 nM for NPFF2 and NPFF1, respectively). Attenuates contractile function of isolated rat and rabbit cardiac myocytes. Reduces...
Reference: HY-W048701
€0.00
(tax incl.)
(((9H-Fluoren-9-yl)methoxy)carbonyl)-D-histidine is a histidine derivative.
Reference: HY-P3743
€0.00
(tax incl.)
p60c-src Substrate is an efficient and specific substrate for p60c-src protein tyrosine kinase (PTK). p60c-src Substrate can be used to synthesize chimeric branched peptides.
Reference: HY-P1574
€0.00
(tax incl.)
[Arg8]-Vasotocin is a vertebrate neurohypophyseal peptide of the vasopressin/oxytocin hormone family.
Reference: HY-P3609
€0.00
(tax incl.)
CR 665 (JNJ 38488502) is a peripherally selective κ-opioid agonist. CR 665 can activate the kappa opioid receptor with EC50 value of 10.9 nM. CR 665 can be used for the research of peripheral pain.
Reference: HY-P2530
€0.00
(tax incl.)
KALA is an amphiphilic peptide that forms an α-helical structure at physiological pH. KALA modifies a plasmid DNA-encapsulating liposomal membrane and is used as a fusogenic peptide in order to achieve effective liver...
Reference: HY-W040416
€0.00
(tax incl.)
(S)-2-(((Benzyloxy)carbonyl)amino)pent-4-enoic acid is a Glycine (HY-Y0966) derivative.
Reference: HY-P0002A
€0.00
(tax incl.)
Protirelin Acetate is a highly conserved neuropeptide that exerts the hormonal control of thyroid-stimulating hormone (TSH) levels as well as neuromodulatory functions.
Reference: HY-P0215A
€0.00
(tax incl.)
Autocamtide-2-related inhibitory peptide, myristoylated TFA is the myristoylated Autocamtide-2-related inhibitory peptide. Autocamtide-2-related inhibitory peptide is a highly specific and potent inhibitor of CaMKII...
Reference: HY-P3204
€0.00
(tax incl.)
POT-4 (AL-78898A), a Compstatin derivative, is a potent inhibitor of complement factor C3 activation. POT-4 can be used for age-related macular degeneration research
Reference: HY-106262B
€0.00
(tax incl.)
Delcasertib (KAI-9803) hydrochloride is a potent and selective δ-protein kinase C (δPKC) inhibitor. Delcasertib (KAI-9803) hydrochloride could ameliorate injury associated with ischemia and reperfusion in animal...
Reference: HY-P2502
€0.00
(tax incl.)
Hepatitis Virus C NS3 Protease Inhibitor 2 is a product-based peptide inhibitor of hepatitis C virus (HCV) NS3 protease, with a Ki of 41 nM.
Reference: HY-W009913
€0.00
(tax incl.)
2-((Carboxymethyl)amino)benzoic acid is a Glycine (HY-Y0966) derivative.
Reference: HY-P1493
€0.00
(tax incl.)
Fibrinopeptide B, human is a 14-aa peptide, released from the amino-terminus of β-chains of fibrinogen by thrombin.
Reference: HY-P3725
€0.00
(tax incl.)
H-Leu-Ser-Phe(NO2)-Nle-Ala-OMe TFA is a substrate for chymosin.
Reference: HY-W091734
€0.00
(tax incl.)
Methyl 4-iodo-L-phenylalaninate hydrochloride is a Phenylalaninate derivative. Methyl 4-iodo-L-phenylalaninate hydrochloride can be used for the preparation of factor XI modulators used in the research of thrombotic...
Reference: HY-P0256
€0.00
(tax incl.)
Apamin (Apamine) is an 18 amino acid peptide neurotoxin found in apitoxin (bee venom), is known as a specifically selective blocker of Ca2+-activated K+ (SK) channels and exhibits anti-inflammatory and anti-fibrotic...
Reference: HY-P1019
€0.00
(tax incl.)
[Ala1,3,11,15]-Endothelin (53-63) is an ETB agonist. [Ala1,3,11,15]-Endothelin (53-63) has selectivity for ETB with IC50 values range from 0.33 nM to 0.61 nM. [Ala1,3,11,15]-Endothelin (53-63) can be used for the...
Reference: HY-P1497
€0.00
(tax incl.)
Bradykinin (1-3) is a 3-amino acid residue peptide. Bradykinin (1-3) is an amino-truncated Bradykinin peptide, cleaved by Prolyl endopeptidase.
Reference: HY-P1257A
€0.00
(tax incl.)
Xenin-8 TFA, a C-terminal octapeptide, is a biologically active fragment of Xenin. Xenin is a 25-amino acid peptide of the neurotensin/xenopsin family. Xenin-8 TFA stimulates basal insulin secretion and potentiates...
Reference: HY-148209
€0.00
(tax incl.)
Balhimycin is a glycopeptide antibiotic, found from the fermentation broth of a Amycolatopsis sp. Balhimycin shows anti-bacterial activity against staphylococci and anaerobes.
Reference: HY-P2317
€0.00
(tax incl.)
Cecropin P1, porcine is an antibacterial peptide that can be isolated from the upper part of the small intestine of the pig. Cecropin P1, porcine shows antibacterial activity against Gram-negative bacteria. Cecropin...
Reference: HY-P1141A
€0.00
(tax incl.)
GLP-1(9-36)amide TFA is a major metabolite of glucagon-like peptide-1-(7-36) amide formed by the enzyme dipeptidyl peptidase-4 (DPP-4). GLP-1(9-36)amide TFA acts as an antagonist to the human pancreatic GLP-1 receptor.
Reference: HY-P3900
€0.00
(tax incl.)
[Tyr0,D-Trp8] Somatostatin is the analog of Somatostatin.
Reference: HY-W011002
€0.00
(tax incl.)
Fmoc-3-Ala(2-thienyl)-OH is an alanine derivative.
Reference: HY-107627
€0.00
(tax incl.)
MCL0020 is a potent and selective melanocortin MC4 receptor antagonist, with an IC50 of 11.63 nM. MCL0020 dose-dependently and significantly attenuates restraint stress-induced anorexia without affecting food intake.
Reference: HY-13541A
€0.00
(tax incl.)
ADH-1 trifluoroacetate is an N-cadherin antagonist, which inhibits N-cadherin mediated cell adhesion.
Reference: HY-P1521
€0.00
(tax incl.)
β-amyloid (15-21) is a fragment of Amyloid-β peptide, maybe used in the research of neurological disease.
Reference: HY-P0189
€0.00
(tax incl.)
ω-Conotoxin GVIA is an inhibitor of the N-type Ca2+ channel.
Reference: HY-P1198A
€0.00
(tax incl.)
Hemokinin 1, human TFA is a selective tachykinin neurokinin 1 (NK1) receptor full agonist. Hemokinin 1, human TFA is a full agonist at NK2 and NK3 receptor. Hemokinin 1, human TFA can produces an opioid-independent...
Reference: HY-W004098
€0.00
(tax incl.)
Boc-D-Met-OH is a Methionine (HY-13694) derivative.
Reference: HY-P1136B
€0.00
(tax incl.)
TAT-Gap19, a Cx mimetic peptide, is a specific connexin43 hemichannel (Cx43 HC) inhibitor. TAT-Gap19 does not inhibits the corresponding Cx43 GJCs. TAT-Gap19 traverses the blood-brain barrier and alleviate liver...
Reference: HY-W141791
€0.00
(tax incl.)
S-tert-Butylmercapto-L-cysteine is a cysteine derivative.
Reference: HY-P0184
€0.00
(tax incl.)
Camstatin, a functionally active 25-residue fragment of PEP-19's IQ motif, binds calmodulin and inhibits neuronal nitric oxide (NO) synthase.
Reference: HY-P1591A
€0.00
(tax incl.)
N-Formyl-Nle-Leu-Phe-Nle-Tyr-Lys TFA (For-Nle-Leu-Phe-Nle-Tyr-Lys-OH TFA) is a formyl peptide receptor (FPR) agonist.
Reference: HY-P1387
€0.00
(tax incl.)
β-Amyloid (1-40) (rat) is a rat form of the amyloid β-peptide, which accumulates as an insoluble extracellular deposit around neurons, giving rise to the senile plaques associated with Alzheimer's disease (AD)....
Reference: HY-P2478
€0.00
(tax incl.)
Human PD-L1 inhibitor V, a human PD-1 protein binding peptide with a Kd value of 3.32 μM. Human PD-L1 inhibitor V inhibit the interaction of hPD-1/hPD-L1.
Reference: HY-108954
€0.00
(tax incl.)
A-30912A nucleus hydrochloride is the product of the reaction catalyzed by Echinocandin B (ECB) deacylase.
Reference: HY-P3716
€0.00
(tax incl.)
H(-Asn-Pro-Asn-Ala)2-OH is an active petide. H(-Asn-Pro-Asn-Ala)2-OH can be used for the research of various biochemical.
Reference: HY-P1717B
€0.00
(tax incl.)
AMY-101 acetate (Cp40 acetate), a peptidic inhibitor of the central complement component C3 (KD = 0.5 nM), inhibits naturally occurring periodontitis in non-human primates (NHPs). AMY-101 acetate (Cp40 acetate)...
Reference: HY-13948B
€0.00
(tax incl.)
Angiotensin II human (Angiotensin II) TFA is a vasoconstrictor and a major bioactive peptide of the renin/angiotensin system. Angiotensin II human TFA plays a central role in regulating human blood pressure, which is...
Reference: HY-P3823
€0.00
(tax incl.)
Asp-Asp-Asp-Asp-Asp-Asp is a polyaspartic acid. The specificity of the catalytic and antigenic sites of influenza virus neuraminidase is related to the number of specific amino acids.
Reference: HY-P1171
€0.00
(tax incl.)
N-terminally acetylated Endomorphin-1 is a modified Endomorphin-1.
Reference: HY-W008958
€0.00
(tax incl.)
Fmoc-MeSer(Bzl)-OH is a serine derivative.
Reference: HY-P3564
€0.00
(tax incl.)
(D-Ser1)-ACTH (1-24) (human, bovine, mouse, ovine, porcine, rabbit, rat) is an adrenocorticotropic hormone (ACTH) analogue.
Reference: HY-P0046
€0.00
(tax incl.)
Glycyl-L-histidyl-L-lysine is a tripeptide consisting of glycine, L-histidine and L-lysine residues joined in sequence. Glycyl-L-histidyl-L-lysine is a hepatotropic immunosuppressor and shows anxiolytic effect....
Reference: HY-106033
€0.00
(tax incl.)
Edotreotide is a somatostatin analogue. Edotreotide bound to various radionuclides, has the potential for the research and diagnosis of certain types of cancer.
Reference: HY-P4038
€0.00
(tax incl.)
Hepatitis C Virus S5A/5B is a synthetic peptide substrate. Hepatitis C Virus S5A/5B mimics the NS5A/5B junction of the nonstructural protein (NS), served as the substrate for the study of HCV NS3 protease activity.
Reference: HY-W002326
€0.00
(tax incl.)
Boc-Asp(OtBu)-OH is an aspartic acid derivative.
Reference: HY-P3727
€0.00
(tax incl.)
Lys-Pro-Pro-Thr-Pro-Pro-Pro-Glu-Pro-Glu-Thr is a undecapeptide, corresponding to the carboxy terminus of simian virus 40 large T antigen. Lys-Pro-Pro-Thr-Pro-Pro-Pro-Glu-Pro-Glu-Thr can be targeted by antibodies...
Reference: HY-P1375A
€0.00
(tax incl.)
[D-Trp7,9,10]-Substance P TFA is a substance P analogue. Substance P stimulates substance P receptors but also inhibits ion conductance through nicotinic acetylcholine receptors.
Reference: HY-13621
€0.00
(tax incl.)
Elisidepsin (PM02734) is cyclic depsipeptide with antineoplastic activity. Elisidepsin inhibits cancer cell proliferation. Elisidepsin can be used in the research of cancers, such as NSCLC.
Reference: HY-P1483A
€0.00
(tax incl.)
Urotensin II, mouse TFA is an endogenous ligand for the orphan G-protein-coupled receptor GPR14 or SENR. Urotensin II, mouse TFA is a potent vasoconstrictor. Urotensin II, mouse TFA plays a physiological role in the...
Reference: HY-W013734
€0.00
(tax incl.)
N,N'-Di-BOC-L-cystine is a cysteine derivative.
Reference: HY-P4078
€0.00
(tax incl.)
(Arg)9 biotin labeled is a cell-permeable peptide. (Arg)9 biotin labeled can be used for drug delivery. (Arg)9 biotin labeled can traverse the plasma membrane of eukaryotic cells.
Reference: HY-P3877
€0.00
(tax incl.)
(Leu31,Pro34)-Peptide YY (human) is a Peptide YY (HY-P1514) derivative and is a potent and selective Y1 agonist with a KD of 1.0 nM.
Reference: HY-W050025
€0.00
(tax incl.)
6-Chloro-L-tryptophan is a Tryptophan derivative. 6-Chloro-L-tryptophan can be used as a substrate for KtzQ.
Reference: HY-P2507
€0.00
(tax incl.)
NY-ESO-1 (87-111) is a pan-MHC class II-restricted peptide sequence. NY-ESO-1 (87-111) binds to multiple HLA-DR and HLA-DP4 molecules, and stimulates Th1-type and Th-2/Th0-type CD4+ T cells when presented in the...
Reference: HY-P1890
€0.00
(tax incl.)
CEF14, EBV Rta Protein (28-37) is the HLA A24-restricted epitope from Epstein-Barr Virus Rta protein (28-37).
Reference: HY-P0243
€0.00
(tax incl.)
Luteinizing Hormone Releasing Hormone (LH-RH), salmon (Salmon GnRH) is the hypophysiotropic decapeptide synthesized in the hypothalamus that plays a crucial role in the control of reproductive functions.
Reference: HY-P1862
€0.00
(tax incl.)
HSV-gB2 (498-505) is an immunodominant epitope from herpes simplex virus (HSV) glycoprotein B residues 498-505, acts as H-2Kb-restricted and HSV-1/2-cross-reactive cytotoxic T-lymphocyte (CTL) recognition epitope.
Reference: HY-P1525A
€0.00
(tax incl.)
Melanin Concentrating Hormone, salmon TFA (MCH (salmon) TFA) is a 19-amino-acid neuropeptide initially identified in the pituitary gland of teleost fish, which regulates food intake, energy balance, sleep state, and...
Quote